Recombinant Human EIF3D protein, GST-tagged
Cat.No. : | EIF3D-12366H |
Product Overview : | Recombinant Human EIF3D protein(323-531 aa), fused with GST tag, was expressed in E.coli. |
Availability | July 07, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 323-531 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | FSQQCLRMGKERYNFPNPNPFVEDDMDKNEIASVAYRYRRWKLGDDIDLIVRCEHDGVMTGANGEVSFINIKTLNEWDSRHCNGVDWRQKLDSQRGAVIATELKNNSYKLARWTCCALLAGSEYLKLGYVSRYHVKDSSRHVILGTQQFKPNEFASQINLSVENAWGILRCVIDICMKLEEGKYLILKDPNKQVIRVYSLPDGTFSSDE |
Purity : | 75%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | EIF3D eukaryotic translation initiation factor 3, subunit D [ Homo sapiens ] |
Official Symbol | EIF3D |
Synonyms | EIF3D; eukaryotic translation initiation factor 3, subunit D; EIF3S7, eukaryotic translation initiation factor 3, subunit 7 zeta, 66/67kDa; eukaryotic translation initiation factor 3 subunit D; eIF3 p66; eIF3 zeta; eIF3d; eIF-3-zeta; translation initiation factor eIF3 p66 subunit; eukaryotic translation initiation factor 3 subunit 7; eukaryotic translation initiation factor 3, subunit 7 zeta, 66/67kDa; EIF3S7; eIF3-p66; eIF3-zeta; MGC17258; MGC126526; |
Gene ID | 8664 |
mRNA Refseq | NM_003753 |
Protein Refseq | NP_003744 |
MIM | 603915 |
UniProt ID | O15371 |
◆ Recombinant Proteins | ||
EIF3D-1694HFL | Recombinant Full Length Human EIF3D Protein, C-Flag-tagged | +Inquiry |
EIF3D-1421R | Recombinant Rhesus monkey EIF3D Protein, His-tagged | +Inquiry |
EIF3D-1245R | Recombinant Rhesus Macaque EIF3D Protein, His (Fc)-Avi-tagged | +Inquiry |
EIF3D-2711M | Recombinant Mouse EIF3D Protein, His (Fc)-Avi-tagged | +Inquiry |
EIF3D-3178H | Recombinant Human EIF3D Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF3D-6663HCL | Recombinant Human EIF3D 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF3D Products
Required fields are marked with *
My Review for All EIF3D Products
Required fields are marked with *