Recombinant Human EIF3D protein, GST-tagged

• Cat.No.: EIF3D-12366H
• Product Overview: Recombinant Human EIF3D protein(323-531 aa), fused with GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 323-531 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: FSQQCLRMGKERYNFPNPNPFVEDDMDKNEIASVAYRYRRWKLGDDIDLIVRCEHDGVMTGANGEVSFINIKTLNEWDSRHCNGVDWRQKLDSQRGAVIATELKNNSYKLARWTCCALLAGSEYLKLGYVSRYHVKDSSRHVILGTQQFKPNEFASQINLSVENAWGILRCVIDICMKLEEGKYLILKDPNKQVIRVYSLPDGTFSSDE
• Purity: 75%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: EIF3D eukaryotic translation initiation factor 3, subunit D [ Homo sapiens ]
• Official Symbol: EIF3D
• Synonyms: EIF3D; eukaryotic translation initiation factor 3, subunit D; EIF3S7, eukaryotic translation initiation factor 3, subunit 7 zeta, 66/67kDa; eukaryotic translation initiation factor 3 subunit D; eIF3 p66; eIF3 zeta; eIF3d; eIF-3-zeta; translation initiation factor eIF3 p66 subunit; eukaryotic translation initiation factor 3 subunit 7; eukaryotic translation initiation factor 3, subunit 7 zeta, 66/67kDa; EIF3S7; eIF3-p66; eIF3-zeta; MGC17258; MGC126526
• Gene ID: 8664
• mRNA Refseq: NM_003753
• Protein Refseq: NP_003744
• MIM: 603915
• UniProt ID: O15371