Recombinant Human EIF3D protein, GST-tagged

Cat.No. : EIF3D-12366H
Product Overview : Recombinant Human EIF3D protein(323-531 aa), fused with GST tag, was expressed in E.coli.
Availability October 10, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 323-531 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : FSQQCLRMGKERYNFPNPNPFVEDDMDKNEIASVAYRYRRWKLGDDIDLIVRCEHDGVMTGANGEVSFINIKTLNEWDSRHCNGVDWRQKLDSQRGAVIATELKNNSYKLARWTCCALLAGSEYLKLGYVSRYHVKDSSRHVILGTQQFKPNEFASQINLSVENAWGILRCVIDICMKLEEGKYLILKDPNKQVIRVYSLPDGTFSSDE
Purity : 75%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name EIF3D eukaryotic translation initiation factor 3, subunit D [ Homo sapiens ]
Official Symbol EIF3D
Synonyms EIF3D; eukaryotic translation initiation factor 3, subunit D; EIF3S7, eukaryotic translation initiation factor 3, subunit 7 zeta, 66/67kDa; eukaryotic translation initiation factor 3 subunit D; eIF3 p66; eIF3 zeta; eIF3d; eIF-3-zeta; translation initiation factor eIF3 p66 subunit; eukaryotic translation initiation factor 3 subunit 7; eukaryotic translation initiation factor 3, subunit 7 zeta, 66/67kDa; EIF3S7; eIF3-p66; eIF3-zeta; MGC17258; MGC126526;
Gene ID 8664
mRNA Refseq NM_003753
Protein Refseq NP_003744
MIM 603915
UniProt ID O15371

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EIF3D Products

Required fields are marked with *

My Review for All EIF3D Products

Required fields are marked with *

0
cart-icon
0
compare icon