Recombinant Human EIF3E
Cat.No. : | EIF3E-26384TH |
Product Overview : | Recombinant fragment corresponding to amino acids 346-445 of Human eIF3e with an N terminal proprietary tag; Predicted MWt 36.63 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | eIF3e is part of the eIF3 complex, which is composed of at least 12 subunits. It binds the 40S ribosome and promotes the binding of methionyl-tRNAi and mRNA. It can bind the COP9 signalosome and the 26S proteasome, possibly having regulatory functions in both protein translation and degradation. Reducing its expression by RNA interference in HeLa cells markedly alters mitosis progression and defects in spindle formation, chromosome segregation and cytokinesis are observed. |
Molecular Weight : | 36.630kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | RIHQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQNSRSEAPNWATQDSGFY |
Gene Name | EIF3E eukaryotic translation initiation factor 3, subunit E [ Homo sapiens ] |
Official Symbol | EIF3E |
Synonyms | EIF3E; eukaryotic translation initiation factor 3, subunit E; EIF3S6, eukaryotic translation initiation factor 3, subunit 6 48kDa , INT6; eukaryotic translation initiation factor 3 subunit E; eIF3 p48; eIF3e; |
Gene ID | 3646 |
mRNA Refseq | NM_001568 |
Protein Refseq | NP_001559 |
MIM | 602210 |
Uniprot ID | P60228 |
Chromosome Location | 8q22-q23 |
Pathway | Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S, organism-specific biosystem; Cap-dependent Translation Initiation, organism-specific biosystem; Eukaryotic Translation Initiation, organism-specific biosystem; Formation of a pool of free 40S subunits, organism-specific biosystem; Formation of the ternary complex, and subsequently, the 43S complex, organism-specific biosystem; |
Function | protein N-terminus binding; protein binding; translation initiation factor activity; contributes_to translation initiation factor activity; contributes_to translation initiation factor activity; |
◆ Recombinant Proteins | ||
EIF3E-2043H | Recombinant Human EIF3E Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
EIF3E-1422R | Recombinant Rhesus monkey EIF3E Protein, His-tagged | +Inquiry |
EIF3E-3179H | Recombinant Human EIF3E Protein, GST-tagged | +Inquiry |
EIF3E-2712M | Recombinant Mouse EIF3E Protein, His (Fc)-Avi-tagged | +Inquiry |
Eif3e-2779M | Recombinant Mouse Eif3e Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF3E-6662HCL | Recombinant Human EIF3E 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF3E Products
Required fields are marked with *
My Review for All EIF3E Products
Required fields are marked with *