Recombinant Human EIF3F Protein, GST-tagged

Cat.No. : EIF3F-3181H
Product Overview : Human EIF3S5 full-length ORF ( AAH00490, 1 a.a. - 357 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : EIF3F (Eukaryotic Translation Initiation Factor 3 Subunit F) is a Protein Coding gene. Among its related pathways are Viral mRNA Translation and Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S. GO annotations related to this gene include thiol-dependent ubiquitin-specific protease activity and translation initiation factor binding. An important paralog of this gene is PSMD7.
Molecular Mass : 64.9 kDa
AA Sequence : MATPAVPVSAPPATPTPVPAAAPASVPAPTPAPAAAPVPAAAPASSSDPAAAAAATAAPGQTPASAQAPAQTPAPALPGPALPGPFPGGRVVRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGRMSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIALNEKLVNL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EIF3F eukaryotic translation initiation factor 3, subunit F [ Homo sapiens ]
Official Symbol EIF3F
Synonyms EIF3F; eukaryotic translation initiation factor 3, subunit F; EIF3S5, eukaryotic translation initiation factor 3, subunit 5 epsilon, 47kDa; eukaryotic translation initiation factor 3 subunit F; eIF3 epsilon; eIF3 p47; eIF3f; eIF3-epsilon; eIF-3-epsilon; eukaryotic translation initiation factor 3, subunit 5 epsilon, 47kDa; eukaryotic translation initiation factor 3, subunit 5 (epsilon, 47kD); EIF3S5; eIF3-p47;
Gene ID 8665
mRNA Refseq NM_003754
Protein Refseq NP_003745
MIM 603914
UniProt ID O00303

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EIF3F Products

Required fields are marked with *

My Review for All EIF3F Products

Required fields are marked with *

0
cart-icon
0
compare icon