Recombinant Human EIF3I protein, T7-tagged
Cat.No. : | EIF3I-223H |
Product Overview : | Recombinant human EIF3I (325aa) fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Protein Length : | 325 a.a. |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGEFMKPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYMGHTGAVWCVDA DWDTKHVLTGSADNSCRLWDCETGKQLALLKTNSAVRTCGFDFGGNIIMFSTDKQMGYQCFVSFFDLRDPSQIDN NEPYMKIPCNDSKITSAVWGPLGECIIAGHESGELNQYSAKSGEVLVNVKEHSRQINDIQLSRDMTMFVTASKDN TAKLFDSTTLEHQKTFRTERPVNSAALSPNYDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHF GPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEFEA |
Purity : | >90% by SDS-PAGE. |
Applications : | 1. May be used for in vitro TGFb1 mediated EMT regulation study with intracellular delivery of this protein.2. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.3. May be used for mapping EIF3I protein-protein interaction.4. May be used as antigen for specific antibody development. |
Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 7 days. |
Gene Name | EIF3I eukaryotic translation initiation factor 3, subunit I [ Homo sapiens ] |
Official Symbol | EIF3I |
Synonyms | EIF3I; eIF3 beta; eIF3 p36; eIF3i; TRIP 1; eIF-3-beta; predicted protein of HQ2242; TGFbeta receptor-interacting protein 1; TGF-beta receptor-interacting protein 1; TRIP1; EIF3S2; TRIP-1; PRO2242; eIF3-p36; eIF3-beta; |
Gene ID | 8668 |
mRNA Refseq | NM_003757 |
Protein Refseq | NP_003748 |
MIM | 603911 |
UniProt ID | Q13347 |
Chromosome Location | 1p34.1 |
Pathway | Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S, organism-specific biosystem; Cap-dependent Translation Initiation, organism-specific biosystem; Eukaryotic Translation Initiation, organism-specific biosystem; Formation of a pool of free 40S subunits, organism-specific biosystem; Formation of the ternary complex, and subsequently, the 43S complex, organism-specific biosystem; GTP hydrolysis and joining of the 60S ribosomal subunit, organism-specific biosystem; Gene Expression, organism-specific biosystem; |
Function | protein binding; contributes_to translation initiation factor activity; translation initiation factor activity; translation initiation factor activity; |
◆ Recombinant Proteins | ||
EIF3I-2633R | Recombinant Rat EIF3I Protein (1-325 aa), His-tagged | +Inquiry |
EIF3I-1534H | Recombinant Human EIF3I, T7-tagged | +Inquiry |
EIF3I-12234Z | Recombinant Zebrafish EIF3I | +Inquiry |
EIF3I-223H | Recombinant Human EIF3I protein, T7-tagged | +Inquiry |
Eif3i-2781M | Recombinant Mouse Eif3i Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF3I-6658HCL | Recombinant Human EIF3I 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF3I Products
Required fields are marked with *
My Review for All EIF3I Products
Required fields are marked with *