Recombinant Human EIF3K, His-tagged

Cat.No. : EIF3K-27408TH
Product Overview : Recombinant fragment: VLKLYQFNPA FFQTTVTAQI LLKALTNLPH TDFTLCKCMI DQAHQ, corresponding to amino acids 50-94 of Human eIF3K fused to a His tag at N-terminal end, 10kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 50-94 a.a.
Description : The 700-kD eukaryotic translation initiation factor-3 (eIF3) is the largest eIF and contains at least 12 subunits, including EIF2S12. eIF3 plays an essential role in translation by binding directly to the 40S ribosomal subunit and promoting formation of the 40S preinitiation complex (Mayeur et al.
Conjugation : HIS
Tissue specificity : Ubiquitous, with the highest levels of expression in brain, testis and kidney.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: PBS
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids : VLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQ
Sequence Similarities : Belongs to the eIF-3 subunit K family.
Gene Name EIF3K eukaryotic translation initiation factor 3, subunit K [ Homo sapiens ]
Official Symbol EIF3K
Synonyms EIF3K; eukaryotic translation initiation factor 3, subunit K; EIF3S12, eukaryotic translation initiation factor 3, subunit 12; eukaryotic translation initiation factor 3 subunit K; ARG134; eIF3k; HSPC029; M9; PLAC 24; PRO1474; PTD001;
Gene ID 27335
mRNA Refseq NM_013234
Protein Refseq NP_037366
MIM 609596
Uniprot ID Q9UBQ5
Chromosome Location 19q13.2
Pathway Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S, organism-specific biosystem; Cap-dependent Translation Initiation, organism-specific biosystem; Eukaryotic Translation Initiation, organism-specific biosystem; Formation of a pool of free 40S subunits, organism-specific biosystem; Formation of the ternary complex, and subsequently, the 43S complex, organism-specific biosystem;
Function binding; ribosome binding; contributes_to translation initiation factor activity; contributes_to translation initiation factor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EIF3K Products

Required fields are marked with *

My Review for All EIF3K Products

Required fields are marked with *

0
cart-icon