Recombinant Human EIF3M, His-tagged
Cat.No. : | EIF3M-29960TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-374 of Human PCID1 with N terminal His tag; Predicted MWt 44 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-374 a.a. |
Description : | HFLB5 encodes a broadly expressed protein containing putative membrane fusion domains that acts as a receptor or coreceptor for entry of herpes simplex virus (HSV) (Perez et al. |
Conjugation : | HIS |
Tissue specificity : | Broadly expressed. |
Form : | Lyophilised:Reconstitute with 159 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHV DLAQIIEACDVCLKEDDKDVESVMNSVVSLLLILEPDK QEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKN TPVRYTVYCSLIKVAASCGAIQYIPTELDQVRKWISDW NLTTEKKHTLLRLLYEALVDCKKSDAASKVMVELLGSYTEDNASQARVDAHRCIVRALKDPNAFLFDHLLTLKPVKFL EGELIHDLLTIFVSAKLASYVKFYQNNKDFIDSLGLLH EQNMAKMRLLTFMGMAVENKEISFDTMQQELQIGADDV EAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQ WQQLYDTLNAWKQNLNKVKNSLLSLSDT |
Sequence Similarities : | Belongs to the eIF-3 subunit M family.Contains 1 PCI domain. |
Full Length : | Full L. |
Gene Name | EIF3M eukaryotic translation initiation factor 3, subunit M [ Homo sapiens ] |
Official Symbol | EIF3M |
Synonyms | EIF3M; eukaryotic translation initiation factor 3, subunit M; PCI domain containing 1 (herpesvirus entry mediator) , PCID1; eukaryotic translation initiation factor 3 subunit M; eIF3m; FLJ29030; GA17; hfl B5; |
Gene ID | 10480 |
mRNA Refseq | NM_006360 |
Protein Refseq | NP_006351 |
MIM | 609641 |
Uniprot ID | Q7L2H7 |
Chromosome Location | 11p13 |
Function | protein binding; contributes_to translation initiation factor activity; |
◆ Recombinant Proteins | ||
EIF3M-392H | Recombinant Human EIF3M protein, His-sumo-tagged | +Inquiry |
EIF3M-12374H | Recombinant Human EIF3M, His-tagged | +Inquiry |
EIF3M-8709HFL | Recombinant Full Length Human EIF3M protein, Flag-tagged | +Inquiry |
EIF3M-394H | Recombinant Human EIF3M protein, GST-tagged | +Inquiry |
EIF3M-393H | Recombinant Human EIF3M protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF3M-6655HCL | Recombinant Human EIF3M 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF3M Products
Required fields are marked with *
My Review for All EIF3M Products
Required fields are marked with *