Recombinant Human EIF4E Protein, GST-tagged

• Cat.No.: EIF4E-3198H
• Product Overview: Human EIF4E full-length ORF ( AAH12611, 1 a.a. - 217 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a component of the eukaryotic translation initiation factor 4F complex, which recognizes the 7-methylguanosine cap structure at the 5' end of messenger RNAs. The encoded protein aids in translation initiation by recruiting ribosomes to the 5'-cap structure. Association of this protein with the 4F complex is the rate-limiting step in translation initiation. This gene acts as a proto-oncogene, and its expression and activation is associated with transformation and tumorigenesis. Several pseudogenes of this gene are found on other chromosomes. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2015]
• Molecular Mass: 49.61 kDa
• AA Sequence: MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLNRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EIF4E eukaryotic translation initiation factor 4E [ Homo sapiens ]
• Official Symbol: EIF4E
• Synonyms: EIF4E; eukaryotic translation initiation factor 4E; EIF4EL1, EIF4F; EIF4E1; eIF-4E; eIF-4F 25 kDa subunit; mRNA cap-binding protein; eukaryotic translation initiation factor 4E-like 1; CBP; EIF4F; EIF4EL1; MGC111573
• Gene ID: 1977
• mRNA Refseq: NM_001130678
• Protein Refseq: NP_001124150
• MIM: 133440
• UniProt ID: P06730