Recombinant Human EIF4E3 protein, GST-tagged
| Cat.No. : | EIF4E3-301533H |
| Product Overview : | Recombinant Human EIF4E3 (1-118 aa) protein, fused to GST tag, was expressed in E. coli. |
| Availability | February 04, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Met1-His118 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | MRGERRPLWEEESNAKGGVWKMKVPKDSTSTVWKELLLATIGEQFTDCAAADDEVIGVSVSVRDREDVVQVWNVNASLVGEATVLEKIYELLPHITFKAVFYKPHEEHHAFEGGRGKH |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | EIF4E3 eukaryotic translation initiation factor 4E family member 3 [ Homo sapiens (human) ] |
| Official Symbol | EIF4E3 |
| Synonyms | eIF-4E3; eIF4E-3 |
| Gene ID | 317649 |
| mRNA Refseq | NM_001134649 |
| Protein Refseq | NP_001128121 |
| MIM | 609896 |
| UniProt ID | Q8N5X7 |
| ◆ Recombinant Proteins | ||
| EIF4E3-1310Z | Recombinant Zebrafish EIF4E3 | +Inquiry |
| EIF4E3-5109M | Recombinant Mouse EIF4E3 Protein | +Inquiry |
| EIF4E3-301533H | Recombinant Human EIF4E3 protein, GST-tagged | +Inquiry |
| EIF4E3-2720M | Recombinant Mouse EIF4E3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| EIF4E3-1430R | Recombinant Rhesus monkey EIF4E3 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF4E3 Products
Required fields are marked with *
My Review for All EIF4E3 Products
Required fields are marked with *
