Recombinant Human EIF4E3 protein, GST-tagged

Cat.No. : EIF4E3-301533H
Product Overview : Recombinant Human EIF4E3 (1-118 aa) protein, fused to GST tag, was expressed in E. coli.
Availability August 23, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Met1-His118
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : MRGERRPLWEEESNAKGGVWKMKVPKDSTSTVWKELLLATIGEQFTDCAAADDEVIGVSVSVRDREDVVQVWNVNASLVGEATVLEKIYELLPHITFKAVFYKPHEEHHAFEGGRGKH
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name EIF4E3 eukaryotic translation initiation factor 4E family member 3 [ Homo sapiens (human) ]
Official Symbol EIF4E3
Synonyms eIF-4E3; eIF4E-3
Gene ID 317649
mRNA Refseq NM_001134649
Protein Refseq NP_001128121
MIM 609896
UniProt ID Q8N5X7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EIF4E3 Products

Required fields are marked with *

My Review for All EIF4E3 Products

Required fields are marked with *

0
cart-icon