Recombinant Human EIF4EBP1 Protein, His-tagged

Cat.No. : EIF4EBP1-1397H
Product Overview : Recombinant human EIF4EBP1 (1-118aa) protein with His tag was expressed in E. coli.
Availability November 25, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-118 a.a.
Description : eIF4E-BP1, also known as eukaryotic translation initiation factor 4E-binding protein 1, is a member of a family of translation repressor proteins. This protein regulates eukaryotic translation initiation factor 4E (eIF4E) activity by preventing its assembly into the eIF4F complex and mediates the regulation of protein translation by hormones, growth factors and other stimuli that signal through the MAP kinase and mTORC1 pathways. Recombinant EIF4EBP1 protein was expressed in E.coli and purified by using conventional chromatography techniques.
Form : Liquid
Molecular Mass : 14.7 kDa (138aa), confirmed by MALDI-TOF. (Molecular weight on SDS-PAGE will appear higher)
AA Sequence : MGSSHHHHHHSSGLVPRGSHMSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI
Purity : > 95% by SDS - PAGE
Applications : SDS-PAGE
Storage : Can be stored at +4 centigrade short term (1-2 weeks). For long term storage, aliquot and store at -20 or -70 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 1 mg/ml (determined by BCA assay)
Storage Buffer : In Phosphate Buffered Saline (pH7.4) containing 10% glycerol
Gene Name EIF4EBP1
Official Symbol EIF4EBP1 eukaryotic translation initiation factor 4E binding protein 1 [ Homo sapiens (human) ]
Synonyms EIF4EBP1; eukaryotic translation initiation factor 4E binding protein 1; BP-1; 4EBP1; 4E-BP1; PHAS-I; eukaryotic translation initiation factor 4E-binding protein 1; eIF4E-binding protein 1; phosphorylated heat- and acid-stable protein regulated by insulin 1
Gene ID 1978
mRNA Refseq NM_004095
Protein Refseq NP_004086
MIM 602223
UniProt ID Q13541

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EIF4EBP1 Products

Required fields are marked with *

My Review for All EIF4EBP1 Products

Required fields are marked with *

0
cart-icon
0
compare icon