Recombinant Human EIF4EBP1 Protein, His-tagged
Cat.No. : | EIF4EBP1-1397H |
Product Overview : | Recombinant human EIF4EBP1 (1-118aa) protein with His tag was expressed in E. coli. |
Availability | April 29, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-118 a.a. |
Description : | eIF4E-BP1, also known as eukaryotic translation initiation factor 4E-binding protein 1, is a member of a family of translation repressor proteins. This protein regulates eukaryotic translation initiation factor 4E (eIF4E) activity by preventing its assembly into the eIF4F complex and mediates the regulation of protein translation by hormones, growth factors and other stimuli that signal through the MAP kinase and mTORC1 pathways. Recombinant EIF4EBP1 protein was expressed in E.coli and purified by using conventional chromatography techniques. |
Form : | Liquid |
Molecular Mass : | 14.7 kDa (138aa), confirmed by MALDI-TOF. (Molecular weight on SDS-PAGE will appear higher) |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI |
Purity : | > 95% by SDS - PAGE |
Applications : | SDS-PAGE |
Storage : | Can be stored at +4 centigrade short term (1-2 weeks). For long term storage, aliquot and store at -20 or -70 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 1 mg/ml (determined by BCA assay) |
Storage Buffer : | In Phosphate Buffered Saline (pH7.4) containing 10% glycerol |
Gene Name | EIF4EBP1 |
Official Symbol | EIF4EBP1 eukaryotic translation initiation factor 4E binding protein 1 [ Homo sapiens (human) ] |
Synonyms | EIF4EBP1; eukaryotic translation initiation factor 4E binding protein 1; BP-1; 4EBP1; 4E-BP1; PHAS-I; eukaryotic translation initiation factor 4E-binding protein 1; eIF4E-binding protein 1; phosphorylated heat- and acid-stable protein regulated by insulin 1 |
Gene ID | 1978 |
mRNA Refseq | NM_004095 |
Protein Refseq | NP_004086 |
MIM | 602223 |
UniProt ID | Q13541 |
◆ Recombinant Proteins | ||
EIF4EBP1-0230H | Recombinant Human EIF4EBP1 Protein (Met1-Ile118), N-His-tagged | +Inquiry |
EIF4EBP1-26388TH | Recombinant Human EIF4EBP1, His-tagged | +Inquiry |
Eif4ebp1-1846M | Recombinant Mouse Eif4ebp1 protein, His-tagged | +Inquiry |
Eif4ebp1-1847R | Recombinant Rat Eif4ebp1 protein, His-tagged | +Inquiry |
EIF4EBP1-1398H | Recombinant Human EIF4EBP1 Protein, Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF4EBP1-6649HCL | Recombinant Human EIF4EBP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EIF4EBP1 Products
Required fields are marked with *
My Review for All EIF4EBP1 Products
Required fields are marked with *
0
Inquiry Basket