Recombinant Human EIF4EBP2 protein, GST-tagged

Cat.No. : EIF4EBP2-2843H
Product Overview : Recombinant Human EIF4EBP2 protein(Q13542)(1-120aa), fused to N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-120aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 39.9 kDa
AA Sequence : MSSSAGSGHQPSQSRAIPTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name EIF4EBP2 eukaryotic translation initiation factor 4E binding protein 2 [ Homo sapiens ]
Official Symbol EIF4EBP2
Synonyms EIF4EBP2; eukaryotic translation initiation factor 4E binding protein 2; eukaryotic translation initiation factor 4E-binding protein 2; 4E-BP2; eIF4E-binding protein 2; phosphorylated, heat and acid stable regulated by insulin protein II; 4EBP2; PHASII;
Gene ID 1979
mRNA Refseq NM_004096
Protein Refseq NP_004087
MIM 602224
UniProt ID Q13542

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EIF4EBP2 Products

Required fields are marked with *

My Review for All EIF4EBP2 Products

Required fields are marked with *

0
cart-icon