Recombinant Human EIF4EBP2 protein, GST-tagged
Cat.No. : | EIF4EBP2-2843H |
Product Overview : | Recombinant Human EIF4EBP2 protein(Q13542)(1-120aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-120aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 39.9 kDa |
AA Sequence : | MSSSAGSGHQPSQSRAIPTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | EIF4EBP2 eukaryotic translation initiation factor 4E binding protein 2 [ Homo sapiens ] |
Official Symbol | EIF4EBP2 |
Synonyms | EIF4EBP2; eukaryotic translation initiation factor 4E binding protein 2; eukaryotic translation initiation factor 4E-binding protein 2; 4E-BP2; eIF4E-binding protein 2; phosphorylated, heat and acid stable regulated by insulin protein II; 4EBP2; PHASII; |
Gene ID | 1979 |
mRNA Refseq | NM_004096 |
Protein Refseq | NP_004087 |
MIM | 602224 |
UniProt ID | Q13542 |
◆ Recombinant Proteins | ||
EIF4EBP2-4294HF | Recombinant Full Length Human EIF4EBP2 Protein, GST-tagged | +Inquiry |
EIF4EBP2-2910H | Recombinant Human EukaryoticTranslation Initiation Factor 4E Binding Protein 2, His-tagged | +Inquiry |
EIF4EBP2-2722M | Recombinant Mouse EIF4EBP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
EIF4EBP2-1431R | Recombinant Rhesus monkey EIF4EBP2 Protein, His-tagged | +Inquiry |
Eif4ebp2-4906M | Recombinant Mouse Eif4ebp2 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF4EBP2-6648HCL | Recombinant Human EIF4EBP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF4EBP2 Products
Required fields are marked with *
My Review for All EIF4EBP2 Products
Required fields are marked with *