Recombinant Human EIF4EBP2, His-tagged
| Cat.No. : | EIF4EBP2-28493TH | 
| Product Overview : | Recombinant full length Human eIF4EBP2 with a N terminal His tag; 140aa, 15.1kDa inclusive of tag. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 120 amino acids | 
| Description : | This gene encodes a member of the eukaryotic translation initiation factor 4E binding protein family. The gene products of this family bind eIF4E and inhibit translation initiation. However, insulin and other growth factors can release this inhibition via a phosphorylation-dependent disruption of their binding to eIF4E. Regulation of protein production through these gene products have been implicated in cell proliferation, cell differentiation and viral infection. | 
| Conjugation : | HIS | 
| Molecular Weight : | 15.100kDa inclusive of tags | 
| Form : | Liquid | 
| Purity : | by SDS-PAGE | 
| Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0 | 
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. | 
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMSSSAGSGHQPSQSRAIPTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI | 
| Sequence Similarities : | Belongs to the eIF4E-binding protein family. | 
| Gene Name | EIF4EBP2 eukaryotic translation initiation factor 4E binding protein 2 [ Homo sapiens ] | 
| Official Symbol | EIF4EBP2 | 
| Synonyms | EIF4EBP2; eukaryotic translation initiation factor 4E binding protein 2; eukaryotic translation initiation factor 4E-binding protein 2; | 
| Gene ID | 1979 | 
| mRNA Refseq | NM_004096 | 
| Protein Refseq | NP_004087 | 
| MIM | 602224 | 
| Uniprot ID | Q13542 | 
| Chromosome Location | 10q21-q22 | 
| Pathway | Translation Factors, organism-specific biosystem; | 
| Function | eukaryotic initiation factor 4E binding; protein binding; | 
| ◆ Recombinant Proteins | ||
| EIF4EBP2-2843H | Recombinant Human EIF4EBP2 protein, GST-tagged | +Inquiry | 
| Eif4ebp2-4903M | Recombinant Mouse Eif4ebp2 protein | +Inquiry | 
| EIF4EBP2-2722M | Recombinant Mouse EIF4EBP2 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| Eif4ebp2-4905M | Recombinant Mouse Eif4ebp2 protein | +Inquiry | 
| EIF4EBP2-1386H | Recombinant Human EIF4EBP2 Protein (1-120 aa), His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| EIF4EBP2-6648HCL | Recombinant Human EIF4EBP2 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF4EBP2 Products
Required fields are marked with *
My Review for All EIF4EBP2 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            