Recombinant Human EIF4EBP3 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | EIF4EBP3-3889H |
| Product Overview : | EIF4EBP3 MS Standard C13 and N15-labeled recombinant protein (NP_003723) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a member of the EIF4EBP family, which consists of proteins that bind to eukaryotic translation initiation factor 4E and regulate its assembly into EIF4F, the multi-subunit translation initiation factor that recognizes the mRNA cap structure. Read-through transcription from the neighboring upstream gene (MASK or ANKHD1) generates a transcript (MASK-BP3) that encodes a protein comprised of the MASK protein sequence for the majority of the protein and a different C-terminus due to an alternate reading frame for the EIF4EBP3 segments. |
| Molecular Mass : | 10.9 kDa |
| AA Sequence : | MSTSTSCPIPGGRDQLPDCYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCCLPQIPGVTTPPTAPLSKLEELKEQETEEEIPDDAQFEMDITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | EIF4EBP3 eukaryotic translation initiation factor 4E binding protein 3 [ Homo sapiens (human) ] |
| Official Symbol | EIF4EBP3 |
| Synonyms | EIF4EBP3; eukaryotic translation initiation factor 4E binding protein 3; eukaryotic translation initiation factor 4E-binding protein 3; 4E BP3; eIF4E-binding protein 3; eukaryotic initiation factor 4E-binding protein 3; 4EBP3; 4E-BP3; |
| Gene ID | 8637 |
| mRNA Refseq | NM_003732 |
| Protein Refseq | NP_003723 |
| MIM | 603483 |
| UniProt ID | O60516 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF4EBP3 Products
Required fields are marked with *
My Review for All EIF4EBP3 Products
Required fields are marked with *



