Recombinant Human EIF4EBP3 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : EIF4EBP3-3889H
Product Overview : EIF4EBP3 MS Standard C13 and N15-labeled recombinant protein (NP_003723) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the EIF4EBP family, which consists of proteins that bind to eukaryotic translation initiation factor 4E and regulate its assembly into EIF4F, the multi-subunit translation initiation factor that recognizes the mRNA cap structure. Read-through transcription from the neighboring upstream gene (MASK or ANKHD1) generates a transcript (MASK-BP3) that encodes a protein comprised of the MASK protein sequence for the majority of the protein and a different C-terminus due to an alternate reading frame for the EIF4EBP3 segments.
Molecular Mass : 10.9 kDa
AA Sequence : MSTSTSCPIPGGRDQLPDCYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCCLPQIPGVTTPPTAPLSKLEELKEQETEEEIPDDAQFEMDITRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name EIF4EBP3 eukaryotic translation initiation factor 4E binding protein 3 [ Homo sapiens (human) ]
Official Symbol EIF4EBP3
Synonyms EIF4EBP3; eukaryotic translation initiation factor 4E binding protein 3; eukaryotic translation initiation factor 4E-binding protein 3; 4E BP3; eIF4E-binding protein 3; eukaryotic initiation factor 4E-binding protein 3; 4EBP3; 4E-BP3;
Gene ID 8637
mRNA Refseq NM_003732
Protein Refseq NP_003723
MIM 603483
UniProt ID O60516

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EIF4EBP3 Products

Required fields are marked with *

My Review for All EIF4EBP3 Products

Required fields are marked with *

0
cart-icon