Recombinant Human EIF4ENIF1 Protein, GST-tagged
| Cat.No. : | EIF4ENIF1-3209H |
| Product Overview : | Human EIF4ENIF1 partial ORF ( NP_062817, 886 a.a. - 985 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is a nucleocytoplasmic shuttle protein for the translation initiation factor eIF4E. This shuttle protein interacts with the importin alpha-beta complex to mediate nuclear import of eIF4E. It is predominantly cytoplasmic; its own nuclear import is regulated by a nuclear localization signal and nuclear export signals. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2009] |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | NPRPGTPLHLAMVQQQLQRSVLHPPGSGSHAAAVSVQTTPQNVPSRSGLPHMHSQLEHRPSQRSSSPVGLAKWFGSDVLQQPLPSMPAKVISVDELEYRQ |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | EIF4ENIF1 eukaryotic translation initiation factor 4E nuclear import factor 1 [ Homo sapiens ] |
| Official Symbol | EIF4ENIF1 |
| Synonyms | EIF4ENIF1; eukaryotic translation initiation factor 4E nuclear import factor 1; eukaryotic translation initiation factor 4E transporter; 4E T; 2610509L04Rik; Clast4; FLJ21601; eIF4E transporter; eIF4E-transporter; 4E-T; FLJ26551; |
| Gene ID | 56478 |
| mRNA Refseq | NM_001164501 |
| Protein Refseq | NP_001157973 |
| MIM | 607445 |
| UniProt ID | Q9NRA8 |
| ◆ Recombinant Proteins | ||
| EIF4ENIF1-3209H | Recombinant Human EIF4ENIF1 Protein, GST-tagged | +Inquiry |
| EIF4ENIF1-2724M | Recombinant Mouse EIF4ENIF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| EIF4ENIF1-5113M | Recombinant Mouse EIF4ENIF1 Protein | +Inquiry |
| EIF4ENIF1-2202Z | Recombinant Zebrafish EIF4ENIF1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EIF4ENIF1-544HCL | Recombinant Human EIF4ENIF1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF4ENIF1 Products
Required fields are marked with *
My Review for All EIF4ENIF1 Products
Required fields are marked with *
