Recombinant Human EIF4G1, GST-tagged
Cat.No. : | EIF4G1-28550TH |
Product Overview : | Recombinant Human EIF4G1(1500 a.a. - 1599 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a component of the multi-subunit protein complex EIF4F. This complex facilitates the recruitment of mRNA to the ribosome, which is a rate-limiting step during the initiation phase of protein synthesis. The recognition of the mRNA cap and the ATP-dependent unwinding of 5'-terminal secondary structure is catalyzed by factors in this complex. The subunit encoded by this gene is a large scaffolding protein that contains binding sites for other members of the EIF4F complex. A domain at its N-terminus can also interact with the poly(A)-binding protein, which may mediate the circularization of mRNA during translation. Alternative splicing results in multiple transcript variants, some of which are derived from alternative promoter usage. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | DVAVLKARAKLLQKYLCDEQKELQALYALQALVVTLEQPPNLLRMFFDALYDEDVVKEDAFYSWESSKDPAEQQG KGVALKSVTAFFKWLREAEEESDHN |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EIF4G1 eukaryotic translation initiation factor 4 gamma, 1 [ Homo sapiens (human) ] |
Official Symbol | EIF4G1 |
Synonyms | EIF4G1; eukaryotic translation initiation factor 4 gamma, 1; P220; EIF4F; EIF4G; EIF4GI; PARK18; EIF-4G1; eukaryotic translation initiation factor 4 gamma 1; EIF4-gamma; eIF-4-gamma 1; eucaryotic translation initiation factor 4G |
Gene ID | 1981 |
mRNA Refseq | NM_182917 |
Protein Refseq | NP_886553 |
MIM | 600495 |
UniProt ID | Q04637 |
Chromosome Location | 3q27.1 |
Pathway | AUF1 (hnRNP D0) destabilizes mRNA; Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S; Antiviral mechanism by IFN-stimulated genes |
Function | poly(A) RNA binding; protein binding; translation factor activity, nucleic acid binding |
◆ Recombinant Proteins | ||
EIF4G1-2844H | Recombinant Human EIF4G1 protein, His-B2M-JD & Myc-tagged | +Inquiry |
EIF4G1-28550TH | Recombinant Human EIF4G1, GST-tagged | +Inquiry |
EIF4G1-1009HFL | Recombinant Full Length Human EIF4G1 Protein, C-Flag-tagged | +Inquiry |
EIF4G1-5398H | Recombinant Human EIF4G1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
EIF4G1-12383H | Recombinant Human EIF4G1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF4G1-545HCL | Recombinant Human EIF4G1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF4G1 Products
Required fields are marked with *
My Review for All EIF4G1 Products
Required fields are marked with *