Recombinant Human EIF4G1, GST-tagged

Cat.No. : EIF4G1-28550TH
Product Overview : Recombinant Human EIF4G1(1500 a.a. - 1599 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Availability September 08, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a component of the multi-subunit protein complex EIF4F. This complex facilitates the recruitment of mRNA to the ribosome, which is a rate-limiting step during the initiation phase of protein synthesis. The recognition of the mRNA cap and the ATP-dependent unwinding of 5'-terminal secondary structure is catalyzed by factors in this complex. The subunit encoded by this gene is a large scaffolding protein that contains binding sites for other members of the EIF4F complex. A domain at its N-terminus can also interact with the poly(A)-binding protein, which may mediate the circularization of mRNA during translation. Alternative splicing results in multiple transcript variants, some of which are derived from alternative promoter usage.
Molecular Mass : 36.74 kDa
AA Sequence : DVAVLKARAKLLQKYLCDEQKELQALYALQALVVTLEQPPNLLRMFFDALYDEDVVKEDAFYSWESSKDPAEQQG KGVALKSVTAFFKWLREAEEESDHN
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EIF4G1 eukaryotic translation initiation factor 4 gamma, 1 [ Homo sapiens (human) ]
Official Symbol EIF4G1
Synonyms EIF4G1; eukaryotic translation initiation factor 4 gamma, 1; P220; EIF4F; EIF4G; EIF4GI; PARK18; EIF-4G1; eukaryotic translation initiation factor 4 gamma 1; EIF4-gamma; eIF-4-gamma 1; eucaryotic translation initiation factor 4G
Gene ID 1981
mRNA Refseq NM_182917
Protein Refseq NP_886553
MIM 600495
UniProt ID Q04637
Chromosome Location 3q27.1
Pathway AUF1 (hnRNP D0) destabilizes mRNA; Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S; Antiviral mechanism by IFN-stimulated genes
Function poly(A) RNA binding; protein binding; translation factor activity, nucleic acid binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EIF4G1 Products

Required fields are marked with *

My Review for All EIF4G1 Products

Required fields are marked with *

0
cart-icon