Recombinant Human EIF5 protein, GST-tagged

Cat.No. : EIF5-27177TH
Product Overview : Recombinant Human EIF5(1 a.a. - 431 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-431 a.a.
Description : Eukaryotic translation initiation factor-5 (EIF5) interacts with the 40S initiation complex to promote hydrolysis of bound GTP with concomitant joining of the 60S ribosomal subunit to the 40S initiation complex. The resulting functional 80S ribosomal initiation complex is then active in peptidyl transfer and chain elongations (summary by Si et al., 1996 [PubMed 8663286]).
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 73.15 kDa
AA Sequence : MSVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVKNDRYI VNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGMLDTHHKLCTFILKNPPENSD SGTGKKEKEKKNRKGKDKENGSVSSSETPPPPPPPNEINPPPHTMEEEEDDDWGEDTTEEAQRRRMDEISDHAKV LTLSDDLERTIEERVNILFDFVKKKKEEGVIDSSDKEIVAEAERLDVKAMGPLVLTEVLFNEKIREQIKKYRRHF LRFCHNNKKAKRYLLHGLECVVAMHQAQLISKIPHILKEMYDADLLEEEVIISWSEKASKKYVSKELAKEIRVKA EPFIKWLKEAEEESSGGEEEDEDENIEVVYSKAASVPKVETVKSDNKDDDIDIDAI
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name EIF5 eukaryotic translation initiation factor 5 [ Homo sapiens ]
Official Symbol EIF5
Synonyms EIF5; eukaryotic translation initiation factor 5; eIF-5; EIF-5A;
Gene ID 1983
mRNA Refseq NM_001969
Protein Refseq NP_001960
MIM 601710
UniProt ID P55010
Chromosome Location 14q32.32
Pathway Cap-dependent Translation Initiation, organism-specific biosystem; Eukaryotic Translation Initiation, organism-specific biosystem; GTP hydrolysis and joining of the 60S ribosomal subunit, organism-specific biosystem; Gene Expression, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; RNA transport, organism-specific biosystem; RNA transport, conserved biosystem;
Function GTP binding; GTPase activity; binding; nucleotide binding; translation factor activity, nucleic acid binding; translation initiation factor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EIF5 Products

Required fields are marked with *

My Review for All EIF5 Products

Required fields are marked with *

0
cart-icon
0
compare icon