Recombinant Human EIF5 protein, GST-tagged
Cat.No. : | EIF5-27177TH |
Product Overview : | Recombinant Human EIF5(1 a.a. - 431 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-431 a.a. |
Description : | Eukaryotic translation initiation factor-5 (EIF5) interacts with the 40S initiation complex to promote hydrolysis of bound GTP with concomitant joining of the 60S ribosomal subunit to the 40S initiation complex. The resulting functional 80S ribosomal initiation complex is then active in peptidyl transfer and chain elongations (summary by Si et al., 1996 [PubMed 8663286]). |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 73.15 kDa |
AA Sequence : | MSVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVKNDRYI VNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGMLDTHHKLCTFILKNPPENSD SGTGKKEKEKKNRKGKDKENGSVSSSETPPPPPPPNEINPPPHTMEEEEDDDWGEDTTEEAQRRRMDEISDHAKV LTLSDDLERTIEERVNILFDFVKKKKEEGVIDSSDKEIVAEAERLDVKAMGPLVLTEVLFNEKIREQIKKYRRHF LRFCHNNKKAKRYLLHGLECVVAMHQAQLISKIPHILKEMYDADLLEEEVIISWSEKASKKYVSKELAKEIRVKA EPFIKWLKEAEEESSGGEEEDEDENIEVVYSKAASVPKVETVKSDNKDDDIDIDAI |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | EIF5 eukaryotic translation initiation factor 5 [ Homo sapiens ] |
Official Symbol | EIF5 |
Synonyms | EIF5; eukaryotic translation initiation factor 5; eIF-5; EIF-5A; |
Gene ID | 1983 |
mRNA Refseq | NM_001969 |
Protein Refseq | NP_001960 |
MIM | 601710 |
UniProt ID | P55010 |
Chromosome Location | 14q32.32 |
Pathway | Cap-dependent Translation Initiation, organism-specific biosystem; Eukaryotic Translation Initiation, organism-specific biosystem; GTP hydrolysis and joining of the 60S ribosomal subunit, organism-specific biosystem; Gene Expression, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; RNA transport, organism-specific biosystem; RNA transport, conserved biosystem; |
Function | GTP binding; GTPase activity; binding; nucleotide binding; translation factor activity, nucleic acid binding; translation initiation factor activity; |
◆ Recombinant Proteins | ||
EIF5-1726R | Recombinant Rat EIF5 Protein, His (Fc)-Avi-tagged | +Inquiry |
EIF5-8633H | Recombinant Human EIF5 protein(Met1-Asp150), GST-tagged | +Inquiry |
EIF5-9994Z | Recombinant Zebrafish EIF5 | +Inquiry |
EIF5-6913HF | Recombinant Full Length Human EIF5 Protein, GST-tagged | +Inquiry |
EIF5-2069R | Recombinant Rat EIF5 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF5-6642HCL | Recombinant Human EIF5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF5 Products
Required fields are marked with *
My Review for All EIF5 Products
Required fields are marked with *
0
Inquiry Basket