Recombinant Human EIF5A2, His-tagged
| Cat.No. : | EIF5A2-27178TH |
| Product Overview : | Recombinant full length Human eIF5A2 with N terminal His tag; 173 amino acids with tag, Predicted MWt 18.9kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 153 amino acids |
| Description : | Eukaryotic translation initiation factor 5A-2 is a protein that in humans is encoded by the EIF5A2 gene. |
| Conjugation : | HIS |
| Molecular Weight : | 18.900kDa inclusive of tags |
| Tissue specificity : | Expressed in ovarian and colorectal cancer cell lines (at protein level). Highly expressed in testis. Overexpressed in some cancer cells. |
| Form : | Liquid |
| Purity : | by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, pH 8.0 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVAIKPCK |
| Sequence Similarities : | Belongs to the eIF-5A family. |
| Gene Name | EIF5A2 eukaryotic translation initiation factor 5A2 [ Homo sapiens ] |
| Official Symbol | EIF5A2 |
| Synonyms | EIF5A2; eukaryotic translation initiation factor 5A2; eukaryotic translation initiation factor 5A-2; |
| Gene ID | 56648 |
| mRNA Refseq | NM_020390 |
| Protein Refseq | NP_065123 |
| MIM | 605782 |
| Uniprot ID | Q9GZV4 |
| Chromosome Location | 3q26.2 |
| Pathway | Hypusine synthesis from eIF5A-lysine, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; Post-translational modification: gamma carboxylation and hypusine formation, organism-specific biosystem; Post-translational protein modification, organism-specific biosystem; |
| Function | RNA binding; protein binding; ribosome binding; translation elongation factor activity; |
| ◆ Recombinant Proteins | ||
| EIF5A2-12459Z | Recombinant Zebrafish EIF5A2 | +Inquiry |
| EIF5A2-7080C | Recombinant Chicken EIF5A2 | +Inquiry |
| EIF5A2-4301HF | Recombinant Full Length Human EIF5A2 Protein, GST-tagged | +Inquiry |
| Eif5a2-2793M | Recombinant Mouse Eif5a2 Protein, Myc/DDK-tagged | +Inquiry |
| EIF5A2-4318H | Recombinant Human EIF5A2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EIF5A2-6640HCL | Recombinant Human EIF5A2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF5A2 Products
Required fields are marked with *
My Review for All EIF5A2 Products
Required fields are marked with *
