Recombinant Human EIF5B Protein, GST-tagged
| Cat.No. : | EIF5B-3217H |
| Product Overview : | Human EIF5B partial ORF ( NP_056988, 1121 a.a. - 1218 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Accurate initiation of translation in eukaryotes is complex and requires many factors, some of which are composed of multiple subunits. The process is simpler in prokaryotes which have only three initiation factors (IF1, IF2, IF3). Two of these factors are conserved in eukaryotes: the homolog of IF1 is eIF1A and the homolog of IF2 is eIF5B. This gene encodes eIF5B. Factors eIF1A and eIF5B interact on the ribosome along with other initiation factors and GTP to position the initiation methionine tRNA on the start codon of the mRNA so that translation initiates accurately. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 36.52 kDa |
| AA Sequence : | QGTPMCVPSKNFVDIGIVTSIEINHKQVDVAKKGQEVCVKIEPIPGESPKMFGRHFEATDILVSKISRQSIDALKDWFRDEMQKSDWQLIVELKKVFE |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | EIF5B eukaryotic translation initiation factor 5B [ Homo sapiens ] |
| Official Symbol | EIF5B |
| Synonyms | EIF5B; eukaryotic translation initiation factor 5B; DKFZp434I036; FLJ10524; IF2; KIAA0741; translation initiation factor IF2; eIF-5B; translation initiation factor IF-2; |
| Gene ID | 9669 |
| mRNA Refseq | NM_015904 |
| Protein Refseq | NP_056988 |
| MIM | 606086 |
| UniProt ID | O60841 |
| ◆ Recombinant Proteins | ||
| EIF5B-3469H | Recombinant Human EIF5B protein, His-tagged | +Inquiry |
| EIF5B-3217H | Recombinant Human EIF5B Protein, GST-tagged | +Inquiry |
| EIF5B-2727M | Recombinant Mouse EIF5B Protein, His (Fc)-Avi-tagged | +Inquiry |
| EIF5B-385H | Recombinant Human EIF5B protein, His-tagged | +Inquiry |
| EIF5B-5118M | Recombinant Mouse EIF5B Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EIF5B-546HCL | Recombinant Human EIF5B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF5B Products
Required fields are marked with *
My Review for All EIF5B Products
Required fields are marked with *



