Recombinant Human EIF5B Protein, GST-tagged

Cat.No. : EIF5B-3217H
Product Overview : Human EIF5B partial ORF ( NP_056988, 1121 a.a. - 1218 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Accurate initiation of translation in eukaryotes is complex and requires many factors, some of which are composed of multiple subunits. The process is simpler in prokaryotes which have only three initiation factors (IF1, IF2, IF3). Two of these factors are conserved in eukaryotes: the homolog of IF1 is eIF1A and the homolog of IF2 is eIF5B. This gene encodes eIF5B. Factors eIF1A and eIF5B interact on the ribosome along with other initiation factors and GTP to position the initiation methionine tRNA on the start codon of the mRNA so that translation initiates accurately. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.52 kDa
AA Sequence : QGTPMCVPSKNFVDIGIVTSIEINHKQVDVAKKGQEVCVKIEPIPGESPKMFGRHFEATDILVSKISRQSIDALKDWFRDEMQKSDWQLIVELKKVFE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EIF5B eukaryotic translation initiation factor 5B [ Homo sapiens ]
Official Symbol EIF5B
Synonyms EIF5B; eukaryotic translation initiation factor 5B; DKFZp434I036; FLJ10524; IF2; KIAA0741; translation initiation factor IF2; eIF-5B; translation initiation factor IF-2;
Gene ID 9669
mRNA Refseq NM_015904
Protein Refseq NP_056988
MIM 606086
UniProt ID O60841

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EIF5B Products

Required fields are marked with *

My Review for All EIF5B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon