Recombinant Human EIF6 protein, T7-tagged
Cat.No. : | EIF6-141H |
Product Overview : | Recombinant human EIF6 (245 aa, Isoform-A) fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Protein Length : | 245 a.a. |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGEFMAVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVHASIAGCRIIG RMCVGNRHGLLVPNNTTDQELQHIRNSLPDTVQIRRVEERLSALGNVTTCNDYVALVHPDLDRETEEILADVLKV EVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDT TSTELSVVESVFKLNEAQPSTIATSMRDSLIDSLT |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro EIF6 mediated ribosome biogenesis pathway regulation study with intracellular delivery of this protein.2. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.3. May be used for mapping EIF6 protein-protein interaction.4. Potential diagnostic biomarker for various diseases, such as Shwachman-Diamond syndrome.5. May be used as antigen for specific antibody development. |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | EIF6 eukaryotic translation initiation factor 6 [ Homo sapiens ] |
Official Symbol | EIF6 |
Synonyms | EIF6; eukaryotic translation initiation factor 6; EIF3A, integrin beta 4 binding protein , ITGB4BP; b(2)gcn; p27BBP; B4 integrin interactor; p27 beta-4 integrin-binding protein; eukaryotic translation initiation factor 3A; CAB; EIF3A; eIF-6; ITGB4BP; p27(BBP); |
Gene ID | 3692 |
mRNA Refseq | NM_002212 |
Protein Refseq | NP_002203 |
MIM | 602912 |
UniProt ID | P56537 |
Chromosome Location | 20q11.2 |
Pathway | Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Ribosome biogenesis in eukaryotes, organism-specific biosystem; Ribosome biogenesis in eukaryotes, conserved biosystem; Translation Factors, organism-specific biosystem; |
Function | protein binding; ribosome binding; translation initiation factor activity; |
◆ Recombinant Proteins | ||
EIF6-141H | Recombinant Human EIF6 protein, T7-tagged | +Inquiry |
EIF6-5119M | Recombinant Mouse EIF6 Protein | +Inquiry |
Eif6-2794M | Recombinant Mouse Eif6 Protein, Myc/DDK-tagged | +Inquiry |
EIF6-11182Z | Recombinant Zebrafish EIF6 | +Inquiry |
EIF6-1729R | Recombinant Rat EIF6 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
EIF6-2911H | Recombinant Human EIF6 Protein, Flag tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF6-245HCL | Recombinant Human EIF6 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EIF6 Products
Required fields are marked with *
My Review for All EIF6 Products
Required fields are marked with *
0
Inquiry Basket