Recombinant Human EIF6 protein, T7-tagged
| Cat.No. : | EIF6-141H |
| Product Overview : | Recombinant human EIF6 (245 aa, Isoform-A) fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | T7 |
| Protein Length : | 245 a.a. |
| Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| AA Sequence : | MASMTGGQQMGRGEFMAVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVHASIAGCRIIG RMCVGNRHGLLVPNNTTDQELQHIRNSLPDTVQIRRVEERLSALGNVTTCNDYVALVHPDLDRETEEILADVLKV EVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDT TSTELSVVESVFKLNEAQPSTIATSMRDSLIDSLT |
| Purity : | >90% by SDS-PAGE |
| Applications : | 1. May be used for in vitro EIF6 mediated ribosome biogenesis pathway regulation study with intracellular delivery of this protein.2. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.3. May be used for mapping EIF6 protein-protein interaction.4. Potential diagnostic biomarker for various diseases, such as Shwachman-Diamond syndrome.5. May be used as antigen for specific antibody development. |
| Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
| Gene Name | EIF6 eukaryotic translation initiation factor 6 [ Homo sapiens ] |
| Official Symbol | EIF6 |
| Synonyms | EIF6; eukaryotic translation initiation factor 6; EIF3A, integrin beta 4 binding protein , ITGB4BP; b(2)gcn; p27BBP; B4 integrin interactor; p27 beta-4 integrin-binding protein; eukaryotic translation initiation factor 3A; CAB; EIF3A; eIF-6; ITGB4BP; p27(BBP); |
| Gene ID | 3692 |
| mRNA Refseq | NM_002212 |
| Protein Refseq | NP_002203 |
| MIM | 602912 |
| UniProt ID | P56537 |
| Chromosome Location | 20q11.2 |
| Pathway | Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Ribosome biogenesis in eukaryotes, organism-specific biosystem; Ribosome biogenesis in eukaryotes, conserved biosystem; Translation Factors, organism-specific biosystem; |
| Function | protein binding; ribosome binding; translation initiation factor activity; |
| ◆ Recombinant Proteins | ||
| EIF6-4305HF | Recombinant Full Length Human EIF6 Protein, GST-tagged | +Inquiry |
| EIF6-5119M | Recombinant Mouse EIF6 Protein | +Inquiry |
| EIF6-2911H | Recombinant Human EIF6 Protein, Flag tagged | +Inquiry |
| EIF6-11182Z | Recombinant Zebrafish EIF6 | +Inquiry |
| EIF6-141H | Recombinant Human EIF6 protein, T7-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EIF6-245HCL | Recombinant Human EIF6 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF6 Products
Required fields are marked with *
My Review for All EIF6 Products
Required fields are marked with *
