"EIF6" Related Products

Expand
Expand
Expand

Recombinant Human EIF6 protein, T7-tagged

Cat.No.: EIF6-141H
Product Overview: Recombinant human EIF6 (245 aa, Isoform-A) fused with T7 Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGEFMAVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVHASIAGCRIIG RMCVGNRHGLLVPNNTTDQELQHIRNSLPDTVQIRRVEERLSALGNVTTCNDYVALVHPDLDRETEEILADVLKV EVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDT TSTELSVVESVFKLNEAQPSTIATSMRDSLIDSLT
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro EIF6 mediated ribosome biogenesis pathway regulation study with intracellular delivery of this protein.2. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.3. May be used for mapping EIF6 protein-protein interaction.4. Potential diagnostic biomarker for various diseases, such as Shwachman-Diamond syndrome.5. May be used as antigen for specific antibody development.
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name: EIF6 eukaryotic translation initiation factor 6 [ Homo sapiens ]
Official Symbol: EIF6
Synonyms: EIF6; eukaryotic translation initiation factor 6; EIF3A, integrin beta 4 binding protein , ITGB4BP; b(2)gcn; p27BBP; B4 integrin interactor; p27 beta-4 integrin-binding protein; eukaryotic translation initiation factor 3A; CAB; EIF3A; eIF-6; ITGB4BP; p27(BBP);
Gene ID: 3692
mRNA Refseq: NM_002212
Protein Refseq: NP_002203
MIM: 602912
UniProt ID: P56537
Chromosome Location: 20q11.2
Pathway: Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Ribosome biogenesis in eukaryotes, organism-specific biosystem; Ribosome biogenesis in eukaryotes, conserved biosystem; Translation Factors, organism-specific biosystem;
Function: protein binding; ribosome binding; translation initiation factor activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.