Recombinant Human ELANE Protein, GST-tagged
Cat.No. : | ELANE-3222H |
Product Overview : | Human ELA2 partial ORF ( NP_001963, 168 a.a. - 267 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six elastase genes which encode structurally similar proteins. The encoded preproprotein is proteolytically processed to generate the active protease. Following activation, this protease hydrolyzes proteins within specialized neutrophil lysosomes, called azurophil granules, as well as proteins of the extracellular matrix. The enzyme may play a role in degenerative and inflammatory diseases through proteolysis of collagen-IV and elastin. This protein also degrades the outer membrane protein A (OmpA) of E. coli as well as the virulence factors of such bacteria as Shigella, Salmonella and Yersinia. Mutations in this gene are associated with cyclic neutropenia and severe congenital neutropenia (SCN). This gene is present in a gene cluster on chromosome 19. [provided by RefSeq, Jan 2016] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | VLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ELANE elastase, neutrophil expressed [ Homo sapiens (human) ] |
Official Symbol | ELANE |
Synonyms | ELANE; elastase, neutrophil expressed; Elastase, Neutrophil Expressed; Medullasin 2; Bone Marrow Serine Protease; Elastase 2, Neutrophil; Neutrophil Elastase; Leukocyte Elastase; PMN Elastase; Elastase-2; ELA2; HLE; Granulocyte-Derived Elastase; Polymorphonuclear Elastase; Human Leukocyte Elastase; EC 3.4.21.37; EC 3.4.21; PMN-E; SCN1; HNE; GE; NE; neutrophil elastase; PMN elastase; bone marrow serine protease; elastase 2, neutrophil; elastase-2; granulocyte-derived elastase; leukocyte elastase; medullasin; polymorphonuclear elastase |
Gene ID | 1991 |
mRNA Refseq | NM_001972 |
Protein Refseq | NP_001963 |
MIM | 130130 |
UniProt ID | P08246 |
◆ Recombinant Proteins | ||
ELANE-2172H | Recombinant Human ELANE Protein, His-tagged | +Inquiry |
ELANE-7584H | Recombinant Human ELANE protein | +Inquiry |
ELANE-2171H | Active Recombinant Human ELANE Protein, His-GST-tagged | +Inquiry |
Elane-2730M | Recombinant Mouse Elane Protein, His (Fc)-Avi-tagged | +Inquiry |
ELANE-3222H | Recombinant Human ELANE Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
ELANE-27537TH | Native Human ELANE | +Inquiry |
ELANE-3221H | Active Native Human ELANE Protein | +Inquiry |
ELANE-001H | Active Native Human ELANE Protein | +Inquiry |
ELANE-8104H | Native Human Neutrophil Elastase | +Inquiry |
ELANE-8236H | Native Human Neutrophil Elastase (ELA-2) | +Inquiry |
◆ Cell & Tissue Lysates | ||
ELANE-2381MCL | Recombinant Mouse ELANE cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ELANE Products
Required fields are marked with *
My Review for All ELANE Products
Required fields are marked with *