Recombinant Human ELAVL4

• Cat.No.: ELAVL4-27181TH
• Product Overview: Recombinant fragment of Human ELAVL4 with an N terminal proprietary tag. Predicted MW 33.22kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 69 amino acids
• Description: HuD otherwise known as ELAV-like protein 4 is a protein that in humans is encoded by the ELAVL4 gene. The HuD/ELAVL4 protein is an RNA-binding protein. HuD is expressed only in neurons and it binds to AU-rich element-containing mRNAs.
• Molecular Weight: 33.220kDa inclusive of tags
• Tissue specificity: Brain.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: VLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFKTNKAHKS
• Sequence Similarities: Belongs to the RRM elav family.Contains 3 RRM (RNA recognition motif) domains.

Gene Information

• Gene Name: ELAVL4 ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D) [ Homo sapiens ]
• Official Symbol: ELAVL4
• Synonyms: ELAVL4; ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D); HUD; ELAV-like protein 4; PNEM
• Gene ID: 1996
• mRNA Refseq: NM_001144774
• Protein Refseq: NP_001138246
• MIM: 168360
• Uniprot ID: P26378
• Chromosome Location: 1p34
• Function: AU-rich element binding; RNA binding; mRNA 3-UTR binding; nucleotide binding