Recombinant Human ELAVL4
Cat.No. : | ELAVL4-27181TH |
Product Overview : | Recombinant fragment of Human ELAVL4 with an N terminal proprietary tag. Predicted MW 33.22kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 69 amino acids |
Description : | HuD otherwise known as ELAV-like protein 4 is a protein that in humans is encoded by the ELAVL4 gene. The HuD/ELAVL4 protein is an RNA-binding protein. HuD is expressed only in neurons and it binds to AU-rich element-containing mRNAs. |
Molecular Weight : | 33.220kDa inclusive of tags |
Tissue specificity : | Brain. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | VLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFKTNKAHKS |
Sequence Similarities : | Belongs to the RRM elav family.Contains 3 RRM (RNA recognition motif) domains. |
Gene Name | ELAVL4 ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D) [ Homo sapiens ] |
Official Symbol | ELAVL4 |
Synonyms | ELAVL4; ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D); HUD; ELAV-like protein 4; PNEM; |
Gene ID | 1996 |
mRNA Refseq | NM_001144774 |
Protein Refseq | NP_001138246 |
MIM | 168360 |
Uniprot ID | P26378 |
Chromosome Location | 1p34 |
Function | AU-rich element binding; RNA binding; mRNA 3-UTR binding; nucleotide binding; |
◆ Recombinant Proteins | ||
ELAVL4-1261R | Recombinant Rhesus Macaque ELAVL4 Protein, His (Fc)-Avi-tagged | +Inquiry |
ELAVL4-1198H | Recombinant Human ELAVL4 Protein, His-SUMO/MYC-tagged | +Inquiry |
Elavl4-1200M | Recombinant Mouse Elavl4 Protein, MYC/DDK-tagged | +Inquiry |
ELAVL4-1437R | Recombinant Rhesus monkey ELAVL4 Protein, His-tagged | +Inquiry |
ELAVL4-8056Z | Recombinant Zebrafish ELAVL4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ELAVL4-6635HCL | Recombinant Human ELAVL4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ELAVL4 Products
Required fields are marked with *
My Review for All ELAVL4 Products
Required fields are marked with *
0
Inquiry Basket