Recombinant Human ELAVL4
| Cat.No. : | ELAVL4-27181TH |
| Product Overview : | Recombinant fragment of Human ELAVL4 with an N terminal proprietary tag. Predicted MW 33.22kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 69 amino acids |
| Description : | HuD otherwise known as ELAV-like protein 4 is a protein that in humans is encoded by the ELAVL4 gene. The HuD/ELAVL4 protein is an RNA-binding protein. HuD is expressed only in neurons and it binds to AU-rich element-containing mRNAs. |
| Molecular Weight : | 33.220kDa inclusive of tags |
| Tissue specificity : | Brain. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | VLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFKTNKAHKS |
| Sequence Similarities : | Belongs to the RRM elav family.Contains 3 RRM (RNA recognition motif) domains. |
| Gene Name | ELAVL4 ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D) [ Homo sapiens ] |
| Official Symbol | ELAVL4 |
| Synonyms | ELAVL4; ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D); HUD; ELAV-like protein 4; PNEM; |
| Gene ID | 1996 |
| mRNA Refseq | NM_001144774 |
| Protein Refseq | NP_001138246 |
| MIM | 168360 |
| Uniprot ID | P26378 |
| Chromosome Location | 1p34 |
| Function | AU-rich element binding; RNA binding; mRNA 3-UTR binding; nucleotide binding; |
| ◆ Recombinant Proteins | ||
| ELAVL4-8056Z | Recombinant Zebrafish ELAVL4 | +Inquiry |
| ELAVL4-3235H | Recombinant Human ELAVL4 Protein, GST-tagged | +Inquiry |
| elavl4-4232W | Recombinant Western clawed frog elavl4 protein, His-tagged | +Inquiry |
| ELAVL4-6393C | Recombinant Chicken ELAVL4 | +Inquiry |
| ELAVL4-3660H | Recombinant Human ELAVL4 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ELAVL4-6635HCL | Recombinant Human ELAVL4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ELAVL4 Products
Required fields are marked with *
My Review for All ELAVL4 Products
Required fields are marked with *



