Active Recombinant Full Length Human ELAVL4 Protein, C-Flag-tagged
Cat.No. : | ELAVL4-197HFL |
Product Overview : | Recombinant Full Length Human ELAVL4 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | May play a role in neuron-specific RNA processing. Protects CDKN1A mRNA from decay by binding to its 3' UTR (By similarity). Binds to AU-rich sequences (AREs) of target mRNAs, including VEGF and FOS mRNA. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | EMSA reaction |
Molecular Mass : | 41.6 kDa |
AA Sequence : | MVMIISTMEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSKTNLIVNYLPQNMTQEEFRSLFGSIG EIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLP KTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPSGATEPITVKFA NNPSQKSSQALLSQLYQSPNRRYPGPLHHQAQRFRLDNLLNMAYGVKRLMSGPVPPSACSPRFSPITIDG MTSLVGMNIPGHTGTGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDE AAMAIASLNGYRLGDRVLQVSFKTNKAHKSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | ELAVL4 ELAV like RNA binding protein 4 [ Homo sapiens (human) ] |
Official Symbol | ELAVL4 |
Synonyms | HUD; PNEM |
Gene ID | 1996 |
mRNA Refseq | NM_021952.5 |
Protein Refseq | NP_068771.2 |
MIM | 168360 |
UniProt ID | P26378 |
◆ Recombinant Proteins | ||
ELAVL4-834H | Recombinant Human ELAVL4 Protein, His (Fc)-Avi-tagged | +Inquiry |
ELAVL4-3660H | Recombinant Human ELAVL4 protein, GST-tagged | +Inquiry |
ELAVL4-1261R | Recombinant Rhesus Macaque ELAVL4 Protein, His (Fc)-Avi-tagged | +Inquiry |
ELAVL4-3235H | Recombinant Human ELAVL4 Protein, GST-tagged | +Inquiry |
elavl4-4232W | Recombinant Western clawed frog elavl4 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ELAVL4-6635HCL | Recombinant Human ELAVL4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ELAVL4 Products
Required fields are marked with *
My Review for All ELAVL4 Products
Required fields are marked with *
0
Inquiry Basket