Recombinant Human ELF2 protein, T7/His-tagged
Cat.No. : | ELF2-158H |
Product Overview : | Recombinant human ELF2 cDNA (533aa, Isoform-II) protein fused with T7-His-TEV cleavage site Tag (29aa)at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 533 a.a. |
Form : | 0.40 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGEFELATSLHEGPTNQLDLLIRAVEASVHSSNAHCTDKTIEAAEALLHME SPTCLRDSRSPVEVFVPPCVSTPEFIHAAMRPDVITETVVEVSTEESEPMDTSPIPTSPDSHEPMKKKKVGRKPK TQQSPISNGSPELGIKKKPREGKGNTTYLWEFLLDLLQDKNTCPRYIKWTQREKGIFKLVDSKAVSKLWGKHKNK PDMNYETMGRALRYYYQRGILAKVEGQRLVYQFKDMPKNIVVIDDDKSETCNEDLAGTTDEKSLERVSLSAESLL KAASSVRSGKNSSPINCSRAEKGVARVVNITSPGHDASSRSPTTTASVSATAAPRTVRVAMQVPVVMTSLGQKIS TVAVQSVNAGAPLITSTSPTTATSPKVVIQTIPTVMPASTENGDKITMQPAKIITIPATQLAQCQLQTKSNLTGS GSINIVGTPLAVRALTPVSIAHGTPVMRLSMPTQQASGQTPPRVISAVIKGPEVKSEAVAKKQEHDVKTLQLVEE KPADGNKTVTHVVVVSAPSAIALPVTMKTEGLVTCEK |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used as specific protein substrate for kinase and ubiquitin (Sumo pathway) related enzyme functional screening assays.2. May be used for ELF2 protein-protein interaction mapping.3. As immunogen for specific antibody production. |
Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 7 days. |
Gene Name | ELF2 E74-like factor 2 (ets domain transcription factor) [ Homo sapiens ] |
Official Symbol | ELF2 |
Synonyms | ELF2; EU32; NERF; NERF 1A; NERF 1B; NERF 2; new Ets-related factor; NERF-2; NERF-1A; NERF-1B; NERF-1a,b; |
Gene ID | 1998 |
mRNA Refseq | NM_006874 |
Protein Refseq | NP_006865 |
MIM | |
UniProt ID | Q15723 |
Chromosome Location | 4q28 |
Pathway | Angiopoietin receptor Tie2-mediated signaling, organism-specific biosystem; |
Function | protein binding; sequence-specific DNA binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
ELF2-158H | Recombinant Human ELF2 protein, T7/His-tagged | +Inquiry |
ELF2-779H | Recombinant Human ELF2 Protein, His-tagged | +Inquiry |
ELF2-5128M | Recombinant Mouse ELF2 Protein | +Inquiry |
ELF2-3238H | Recombinant Human ELF2 Protein, GST-tagged | +Inquiry |
ELF2-2733M | Recombinant Mouse ELF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ELF2-6634HCL | Recombinant Human ELF2 293 Cell Lysate | +Inquiry |
ELF2-6633HCL | Recombinant Human ELF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ELF2 Products
Required fields are marked with *
My Review for All ELF2 Products
Required fields are marked with *
0
Inquiry Basket