Recombinant Human ELF2 protein, T7/His-tagged
| Cat.No. : | ELF2-158H | 
| Product Overview : | Recombinant human ELF2 cDNA (533aa, Isoform-II) protein fused with T7-His-TEV cleavage site Tag (29aa)at N-terminal was expressed in E. coli. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His&T7 | 
| Protein Length : | 533 a.a. | 
| Form : | 0.40 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and glycerol. | 
| AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGEFELATSLHEGPTNQLDLLIRAVEASVHSSNAHCTDKTIEAAEALLHME SPTCLRDSRSPVEVFVPPCVSTPEFIHAAMRPDVITETVVEVSTEESEPMDTSPIPTSPDSHEPMKKKKVGRKPK TQQSPISNGSPELGIKKKPREGKGNTTYLWEFLLDLLQDKNTCPRYIKWTQREKGIFKLVDSKAVSKLWGKHKNK PDMNYETMGRALRYYYQRGILAKVEGQRLVYQFKDMPKNIVVIDDDKSETCNEDLAGTTDEKSLERVSLSAESLL KAASSVRSGKNSSPINCSRAEKGVARVVNITSPGHDASSRSPTTTASVSATAAPRTVRVAMQVPVVMTSLGQKIS TVAVQSVNAGAPLITSTSPTTATSPKVVIQTIPTVMPASTENGDKITMQPAKIITIPATQLAQCQLQTKSNLTGS GSINIVGTPLAVRALTPVSIAHGTPVMRLSMPTQQASGQTPPRVISAVIKGPEVKSEAVAKKQEHDVKTLQLVEE KPADGNKTVTHVVVVSAPSAIALPVTMKTEGLVTCEK | 
| Purity : | >90% by SDS-PAGE | 
| Applications : | 1. May be used as specific protein substrate for kinase and ubiquitin (Sumo pathway) related enzyme functional screening assays.2. May be used for ELF2 protein-protein interaction mapping.3. As immunogen for specific antibody production. | 
| Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 7 days. | 
| Gene Name | ELF2 E74-like factor 2 (ets domain transcription factor) [ Homo sapiens ] | 
| Official Symbol | ELF2 | 
| Synonyms | ELF2; EU32; NERF; NERF 1A; NERF 1B; NERF 2; new Ets-related factor; NERF-2; NERF-1A; NERF-1B; NERF-1a,b; | 
| Gene ID | 1998 | 
| mRNA Refseq | NM_006874 | 
| Protein Refseq | NP_006865 | 
| MIM | |
| UniProt ID | Q15723 | 
| Chromosome Location | 4q28 | 
| Pathway | Angiopoietin receptor Tie2-mediated signaling, organism-specific biosystem; | 
| Function | protein binding; sequence-specific DNA binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific DNA binding transcription factor activity; | 
| ◆ Recombinant Proteins | ||
| ELF2-3238H | Recombinant Human ELF2 Protein, GST-tagged | +Inquiry | 
| ELF2-779H | Recombinant Human ELF2 Protein, His-tagged | +Inquiry | 
| ELF2-5128M | Recombinant Mouse ELF2 Protein | +Inquiry | 
| ELF2-4342HF | Recombinant Full Length Human ELF2 Protein, GST-tagged | +Inquiry | 
| ELF2-158H | Recombinant Human ELF2 protein, T7/His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| ELF2-6634HCL | Recombinant Human ELF2 293 Cell Lysate | +Inquiry | 
| ELF2-6633HCL | Recombinant Human ELF2 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All ELF2 Products
Required fields are marked with *
My Review for All ELF2 Products
Required fields are marked with *
  
        
    
      
            