Recombinant Human ELK1 Protein, GST-tagged
| Cat.No. : | ELK1-3243H |
| Product Overview : | Human ELK1 partial ORF ( NP_005220, 67 a.a. - 166 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene is a member of the Ets family of transcription factors and of the ternary complex factor (TCF) subfamily. Proteins of the TCF subfamily form a ternary complex by binding to the the serum response factor and the serum response element in the promoter of the c-fos proto-oncogene. The protein encoded by this gene is a nuclear target for the ras-raf-MAPK signaling cascade. This gene produces multiple isoforms by using alternative translational start codons and by alternative splicing. Related pseudogenes have been identified on chromosomes 7 and 14. [provided by RefSeq, Mar 2012] |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | YYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSTMPNVAPAAIHAAPGDTVSGKPGTPKGAGMAGPGGLARSSRNEYMRSGLYSTFTIQS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ELK1 ELK1, member of ETS oncogene family [ Homo sapiens ] |
| Official Symbol | ELK1 |
| Synonyms | ELK1; ELK1, member of ETS oncogene family; ETS domain-containing protein Elk-1; ETS-like gene 1; tyrosine kinase (ELK1) oncogene; |
| Gene ID | 2002 |
| mRNA Refseq | NM_001114123 |
| Protein Refseq | NP_001107595 |
| MIM | 311040 |
| UniProt ID | P19419 |
| ◆ Recombinant Proteins | ||
| ELK1-6922H | Recombinant Human ELK1 protein(Met 1-Pro 428), His-GST-tagged | +Inquiry |
| ELK1-31H | Recombinant Human ELK1, His-tagged, Myc-tagged | +Inquiry |
| ELK1-1442R | Recombinant Rhesus monkey ELK1 Protein, His-tagged | +Inquiry |
| ELK1-27228TH | Recombinant Human ELK1, C-MYC-tagged | +Inquiry |
| ELK1-5134M | Recombinant Mouse ELK1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ELK1-520HCL | Recombinant Human ELK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ELK1 Products
Required fields are marked with *
My Review for All ELK1 Products
Required fields are marked with *




