Recombinant Human ELK1 Protein, GST-tagged

Cat.No. : ELK1-3243H
Product Overview : Human ELK1 partial ORF ( NP_005220, 67 a.a. - 166 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is a member of the Ets family of transcription factors and of the ternary complex factor (TCF) subfamily. Proteins of the TCF subfamily form a ternary complex by binding to the the serum response factor and the serum response element in the promoter of the c-fos proto-oncogene. The protein encoded by this gene is a nuclear target for the ras-raf-MAPK signaling cascade. This gene produces multiple isoforms by using alternative translational start codons and by alternative splicing. Related pseudogenes have been identified on chromosomes 7 and 14. [provided by RefSeq, Mar 2012]
Molecular Mass : 36.74 kDa
AA Sequence : YYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSTMPNVAPAAIHAAPGDTVSGKPGTPKGAGMAGPGGLARSSRNEYMRSGLYSTFTIQS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ELK1 ELK1, member of ETS oncogene family [ Homo sapiens ]
Official Symbol ELK1
Synonyms ELK1; ELK1, member of ETS oncogene family; ETS domain-containing protein Elk-1; ETS-like gene 1; tyrosine kinase (ELK1) oncogene;
Gene ID 2002
mRNA Refseq NM_001114123
Protein Refseq NP_001107595
MIM 311040
UniProt ID P19419

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ELK1 Products

Required fields are marked with *

My Review for All ELK1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon