Recombinant Human ELK1 Protein, GST-tagged
Cat.No. : | ELK1-3243H |
Product Overview : | Human ELK1 partial ORF ( NP_005220, 67 a.a. - 166 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is a member of the Ets family of transcription factors and of the ternary complex factor (TCF) subfamily. Proteins of the TCF subfamily form a ternary complex by binding to the the serum response factor and the serum response element in the promoter of the c-fos proto-oncogene. The protein encoded by this gene is a nuclear target for the ras-raf-MAPK signaling cascade. This gene produces multiple isoforms by using alternative translational start codons and by alternative splicing. Related pseudogenes have been identified on chromosomes 7 and 14. [provided by RefSeq, Mar 2012] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | YYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSTMPNVAPAAIHAAPGDTVSGKPGTPKGAGMAGPGGLARSSRNEYMRSGLYSTFTIQS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ELK1 ELK1, member of ETS oncogene family [ Homo sapiens ] |
Official Symbol | ELK1 |
Synonyms | ELK1; ELK1, member of ETS oncogene family; ETS domain-containing protein Elk-1; ETS-like gene 1; tyrosine kinase (ELK1) oncogene; |
Gene ID | 2002 |
mRNA Refseq | NM_001114123 |
Protein Refseq | NP_001107595 |
MIM | 311040 |
UniProt ID | P19419 |
◆ Recombinant Proteins | ||
ELK1-1442R | Recombinant Rhesus monkey ELK1 Protein, His-tagged | +Inquiry |
ELK1-6923H | Active Recombinant Full Length Human ELK1 Protein (M1-P428), N-GST/6×His tagged | +Inquiry |
ELK1-27228TH | Recombinant Human ELK1, C-MYC-tagged | +Inquiry |
ELK1-2738M | Recombinant Mouse ELK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ELK1-4841H | Recombinant Human ELK1, Member Of ETS Oncogene Family, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ELK1-520HCL | Recombinant Human ELK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ELK1 Products
Required fields are marked with *
My Review for All ELK1 Products
Required fields are marked with *
0
Inquiry Basket