Recombinant Human ELL2 Protein, GST-tagged

Cat.No. : ELL2-3249H
Product Overview : Human ELL2 partial ORF ( NP_036213, 253 a.a. - 352 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ELL2 (Elongation Factor For RNA Polymerase II 2) is a Protein Coding gene. Among its related pathways are Gene Expression and RNA polymerase II transcribes snRNA genes. An important paralog of this gene is ELL.
Molecular Mass : 36.74 kDa
AA Sequence : SKDLSYTLKDYVFKELQRDWPGYSEIDRRSLESVLSRKLNPSQNATGTSRSESPVCSSRDAVSSPQKRLLDSEFIDPLMNKKARISHLTNRVPPTLNGHL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ELL2 elongation factor, RNA polymerase II, 2 [ Homo sapiens ]
Official Symbol ELL2
Synonyms ELL2; elongation factor, RNA polymerase II, 2; RNA polymerase II elongation factor ELL2; ELL-related RNA polymerase II, elongation factor;
Gene ID 22936
mRNA Refseq NM_012081
Protein Refseq NP_036213
MIM 601874
UniProt ID O00472

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ELL2 Products

Required fields are marked with *

My Review for All ELL2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon