Recombinant Human ELL2 Protein, GST-tagged
Cat.No. : | ELL2-3249H |
Product Overview : | Human ELL2 partial ORF ( NP_036213, 253 a.a. - 352 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ELL2 (Elongation Factor For RNA Polymerase II 2) is a Protein Coding gene. Among its related pathways are Gene Expression and RNA polymerase II transcribes snRNA genes. An important paralog of this gene is ELL. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | SKDLSYTLKDYVFKELQRDWPGYSEIDRRSLESVLSRKLNPSQNATGTSRSESPVCSSRDAVSSPQKRLLDSEFIDPLMNKKARISHLTNRVPPTLNGHL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ELL2 elongation factor, RNA polymerase II, 2 [ Homo sapiens ] |
Official Symbol | ELL2 |
Synonyms | ELL2; elongation factor, RNA polymerase II, 2; RNA polymerase II elongation factor ELL2; ELL-related RNA polymerase II, elongation factor; |
Gene ID | 22936 |
mRNA Refseq | NM_012081 |
Protein Refseq | NP_036213 |
MIM | 601874 |
UniProt ID | O00472 |
◆ Recombinant Proteins | ||
ELL2-5436Z | Recombinant Zebrafish ELL2 | +Inquiry |
ELL2-2742M | Recombinant Mouse ELL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ELL2-3249H | Recombinant Human ELL2 Protein, GST-tagged | +Inquiry |
ELL2-5138M | Recombinant Mouse ELL2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ELL2-6625HCL | Recombinant Human ELL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ELL2 Products
Required fields are marked with *
My Review for All ELL2 Products
Required fields are marked with *