Recombinant Human ELL3 Protein, GST-tagged
Cat.No. : | ELL3-3250H |
Product Overview : | Human ELL3 full-length ORF ( AAH19293, 1 a.a. - 397 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ELL3 (Elongation Factor For RNA Polymerase II 3) is a Protein Coding gene. Among its related pathways are Gene Expression and RNA polymerase II transcribes snRNA genes. GO annotations related to this gene include enhancer binding. An important paralog of this gene is ELL2. |
Molecular Mass : | 69.41 kDa |
AA Sequence : | MEELQEPLRGQLRLCFTQAARTSLLLLRLNDAALRALQECQRQQVRPVIAFQGHRGYLRLPGPGWSCLFSFIVSQCCQEGAGGSLDLVCQRFLRSGPNSLHCLGSLRERLIIWAAMDSIPAPSSVQGHNLTEDARHPESWQNTGGYSEGDAVSQPQMALEEVSVSDPLASNQGQSLPGSSREHMAQWEVRSQTHVPNREPVQALPSSASRKRLDKKRSVPVATVELEEKRFRTLPLVPSPLQGLTNQDLQEGEDWEQEDEDMGPRLEHSSSVQEDSESPSPEDIPDYLLQYRAIHSAEQQHAYEQDFETDYAEYRILHARVGTASQRFIELGAEIKRVRRGTPEYKVLEDKIIQEYKKFRKQYPSYREEKRRCEYLHQKLSHIKGLILEFEEKNRGS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ELL3 elongation factor RNA polymerase II-like 3 [ Homo sapiens ] |
Official Symbol | ELL3 |
Synonyms | ELL3; elongation factor RNA polymerase II-like 3; RNA polymerase II elongation factor ELL3; FLJ22637; |
Gene ID | 80237 |
mRNA Refseq | NM_025165 |
Protein Refseq | NP_079441 |
MIM | 609885 |
UniProt ID | Q9HB65 |
◆ Recombinant Proteins | ||
ELL3-2075R | Recombinant Rat ELL3 Protein | +Inquiry |
ELL3-3250H | Recombinant Human ELL3 Protein, GST-tagged | +Inquiry |
ELL3-12408H | Recombinant Human ELL3, GST-tagged | +Inquiry |
ELL3-4358HF | Recombinant Full Length Human ELL3 Protein, GST-tagged | +Inquiry |
ELL3-1732R | Recombinant Rat ELL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ELL3-6624HCL | Recombinant Human ELL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ELL3 Products
Required fields are marked with *
My Review for All ELL3 Products
Required fields are marked with *