Recombinant Human ELMO1 protein, GST-tagged
Cat.No. : | ELMO1-6754H |
Product Overview : | Recombinant Human ELMO1 protein(76-158 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | GST |
Protein Length : | 76-158 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | RLTTSPAQNAQQLHERIQSSSMDAKLEALKDLASLSRDVTFAQEFINLDGISLLTQMVESGTERYQKLQKIMKPCFGDMLSFT |
Purity : | 80%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | ELMO1 engulfment and cell motility 1 [ Homo sapiens ] |
Official Symbol | ELMO1 |
Synonyms | ELMO1; engulfment and cell motility 1; engulfment and cell motility 1 (ced 12 homolog, C. elegans); engulfment and cell motility protein 1; CED 12; CED12; ELMO 1; KIAA0281; ced-12 homolog 1; CED-12; ELMO-1; MGC126406; |
mRNA Refseq | NM_001039459 |
Protein Refseq | NP_001034548 |
MIM | 606420 |
UniProt ID | Q92556 |
Gene ID | 9844 |
◆ Recombinant Proteins | ||
ELMO1-4380H | Recombinant Human ELMO1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ELMO1-1269R | Recombinant Rhesus Macaque ELMO1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ELMO1-6754H | Recombinant Human ELMO1 protein, GST-tagged | +Inquiry |
ELMO1-12317Z | Recombinant Zebrafish ELMO1 | +Inquiry |
ELMO1-1445R | Recombinant Rhesus monkey ELMO1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ELMO1-6622HCL | Recombinant Human ELMO1 293 Cell Lysate | +Inquiry |
ELMO1-6623HCL | Recombinant Human ELMO1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ELMO1 Products
Required fields are marked with *
My Review for All ELMO1 Products
Required fields are marked with *