Recombinant Human ELMO2 protein, GST-tagged
Cat.No. : | ELMO2-301386H |
Product Overview : | Recombinant Human ELMO2 (1-60 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Ala60 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MERTQSSNMETRLDAMKELAKLSADVTFATEFINMDGIIVLTRLVESGTKLLSHYSEMLA |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | ELMO2 engulfment and cell motility 2 [ Homo sapiens ] |
Official Symbol | ELMO2 |
Synonyms | ELMO2; engulfment and cell motility 2; engulfment and cell motility 2 (ced 12 homolog, C. elegans); engulfment and cell motility protein 2; CED 12; CED12; ELMO 2; FLJ11656; KIAA1834; hCed-12A; ced-12 homolog 2; PH domain protein CED12A; protein ced-12 homolog A; CED-12; ELMO-2; |
Gene ID | 63916 |
mRNA Refseq | NM_133171 |
Protein Refseq | NP_573403 |
MIM | 606421 |
UniProt ID | Q96JJ3 |
◆ Recombinant Proteins | ||
ELMO2-1270R | Recombinant Rhesus Macaque ELMO2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ELMO2-4360HF | Recombinant Full Length Human ELMO2 Protein, GST-tagged | +Inquiry |
Elmo2-992M | Recombinant Mouse Elmo2 Protein, MYC/DDK-tagged | +Inquiry |
ELMO2-695H | Recombinant Human ELMO2 Protein, His-tagged | +Inquiry |
ELMO2-3253H | Recombinant Human ELMO2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ELMO2-6621HCL | Recombinant Human ELMO2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ELMO2 Products
Required fields are marked with *
My Review for All ELMO2 Products
Required fields are marked with *
0
Inquiry Basket