Recombinant Human ELN protein(141-540 aa), C-His-tagged
| Cat.No. : | ELN-2660H |
| Product Overview : | Recombinant Human ELN protein(P15502)(141-540 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 141-540 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | VPGVGLPGVYPGGVLPGARFPGVGVLPGVPTGAGVKPKAPGVGGAFAGIPGVGPFGGPQPGVPLGYPIKAPKLPGGYGLPYTTGKLPYGYGPGGVAGAAGKAGYPTGTGVGPQAAAAAAAKAAAKFGAGAAGVLPGVGGAGVPGVPGAIPGIGGIAGVGTPAAAAAAAAAAKAAKYGAAAGLVPGGPGFGPGVVGVPGAGVPGVGVPGAGIPVVPGAGIPGAAVPGVVSPEAAAKAAAKAAKYGARPGVGVGGIPTYGVGAGGFPGFGVGVGGIPGVAGVPGVGGVPGVGGVPGVGISPEAQAAAAAKAAKYGAAGAGVLGGLVPGAPGAVPGVPGTGGVPGVGTPAAAAAKAAAKAAQFGLVPGVGVAPGVGVAPGVGVAPGVGLAPGVGVAPGVGVAP |
| Gene Name | ELN elastin [ Homo sapiens ] |
| Official Symbol | ELN |
| Synonyms | ELN; elastin; supravalvular aortic stenosis; SVAS; tropoelastin; WBS; Williams Beuren syndrome; WS; FLJ38671; FLJ43523; |
| Gene ID | 2006 |
| mRNA Refseq | NM_000501 |
| Protein Refseq | NP_000492 |
| MIM | 130160 |
| UniProt ID | P15502 |
| ◆ Recombinant Proteins | ||
| ELN-2660H | Recombinant Human ELN protein(141-540 aa), C-His-tagged | +Inquiry |
| ELN-4364HF | Recombinant Full Length Human ELN Protein, GST-tagged | +Inquiry |
| ELN-2845H | Recombinant Human ELN Protein, His (Fc)-Avi-tagged | +Inquiry |
| ELN-2749M | Recombinant Mouse ELN Protein, His (Fc)-Avi-tagged | +Inquiry |
| ELN-5145M | Recombinant Mouse ELN Protein | +Inquiry |
| ◆ Native Proteins | ||
| ELN-01H | Active Native Human ELN Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ELN-550HCL | Recombinant Human ELN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ELN Products
Required fields are marked with *
My Review for All ELN Products
Required fields are marked with *
