Recombinant Human ELN protein(141-540 aa), C-His-tagged
Cat.No. : | ELN-2660H |
Product Overview : | Recombinant Human ELN protein(P15502)(141-540 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 141-540 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | VPGVGLPGVYPGGVLPGARFPGVGVLPGVPTGAGVKPKAPGVGGAFAGIPGVGPFGGPQPGVPLGYPIKAPKLPGGYGLPYTTGKLPYGYGPGGVAGAAGKAGYPTGTGVGPQAAAAAAAKAAAKFGAGAAGVLPGVGGAGVPGVPGAIPGIGGIAGVGTPAAAAAAAAAAKAAKYGAAAGLVPGGPGFGPGVVGVPGAGVPGVGVPGAGIPVVPGAGIPGAAVPGVVSPEAAAKAAAKAAKYGARPGVGVGGIPTYGVGAGGFPGFGVGVGGIPGVAGVPGVGGVPGVGGVPGVGISPEAQAAAAAKAAKYGAAGAGVLGGLVPGAPGAVPGVPGTGGVPGVGTPAAAAAKAAAKAAQFGLVPGVGVAPGVGVAPGVGVAPGVGLAPGVGVAPGVGVAP |
Gene Name | ELN elastin [ Homo sapiens ] |
Official Symbol | ELN |
Synonyms | ELN; elastin; supravalvular aortic stenosis; SVAS; tropoelastin; WBS; Williams Beuren syndrome; WS; FLJ38671; FLJ43523; |
Gene ID | 2006 |
mRNA Refseq | NM_000501 |
Protein Refseq | NP_000492 |
MIM | 130160 |
UniProt ID | P15502 |
◆ Recombinant Proteins | ||
ELN-202H | Recombinant Human ELN | +Inquiry |
Eln-6834M | Recombinant Mouse Eln protein, His-GST-tagged | +Inquiry |
ELN-2749M | Recombinant Mouse ELN Protein, His (Fc)-Avi-tagged | +Inquiry |
ELN-5145M | Recombinant Mouse ELN Protein | +Inquiry |
Eln-2845M | Recombinant Mouse Eln protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
ELN-01H | Active Native Human ELN Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ELN-550HCL | Recombinant Human ELN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ELN Products
Required fields are marked with *
My Review for All ELN Products
Required fields are marked with *
0
Inquiry Basket