Recombinant Human ELOVL2 Protein, GST-tagged
Cat.No. : | ELOVL2-3261H |
Product Overview : | Human ELOVL2 full-length ORF ( NP_060240.2, 1 a.a. - 296 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ELOVL2 (ELOVL Fatty Acid Elongase 2) is a Protein Coding gene. Among its related pathways are Fatty acid elongation and Fatty Acyl-CoA Biosynthesis. GO annotations related to this gene include transferase activity, transferring acyl groups other than amino-acyl groups and fatty acid elongase activity. An important paralog of this gene is ELOVL5. |
Molecular Mass : | 61 kDa |
AA Sequence : | MEHLKAFDDEINAFLDNMFGPRDSRVRGWFMLDSYLPTFFLTVMYLLSIWLGNKYMKNRPALSLRGILTLYNLGITLLSAYMLAELILSTWEGGYNLQCQDLTSAGEADIRVAKVLWWYYFSKSVEFLDTIFFVLRKKTSQITFLHVYHHASMFNIWWCVLNWIPCGQSFFGPTLNSFIHILMYSYYGLSVFPSMHKYLWWKKYLTQAQLVQFVLAITHTMSAVVKPCGFPFGCLIFQSSYMLTLVILFLNFYVQTYRKKPMKKDMQEPPAGKEVKNGFSKAYFTAANGVMNKKAQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ELOVL2 ELOVL fatty acid elongase 2 [ Homo sapiens ] |
Official Symbol | ELOVL2 |
Synonyms | ELOVL2; ELOVL fatty acid elongase 2; elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast) like 2; elongation of very long chain fatty acids protein 2; Ssc2; ELOVL FA elongase 2; 3-keto acyl-CoA synthase ELOVL2; elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 2; SSC2; FLJ20334; |
Gene ID | 54898 |
mRNA Refseq | NM_017770 |
Protein Refseq | NP_060240 |
MIM | 611814 |
UniProt ID | Q9NXB9 |
◆ Recombinant Proteins | ||
ELOVL2-4224HF | Recombinant Full Length Human ELOVL2 Protein, GST-tagged | +Inquiry |
ELOVL2-3261H | Recombinant Human ELOVL2 Protein, GST-tagged | +Inquiry |
ELOVL2-4172C | Recombinant Chicken ELOVL2 | +Inquiry |
ELOVL2-2078R | Recombinant Rat ELOVL2 Protein | +Inquiry |
ELOVL2-3785Z | Recombinant Zebrafish ELOVL2 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ELOVL2 Products
Required fields are marked with *
My Review for All ELOVL2 Products
Required fields are marked with *