Recombinant Human ELOVL2 Protein, GST-tagged

• Cat.No.: ELOVL2-3261H
• Product Overview: Human ELOVL2 full-length ORF ( NP_060240.2, 1 a.a. - 296 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: ELOVL2 (ELOVL Fatty Acid Elongase 2) is a Protein Coding gene. Among its related pathways are Fatty acid elongation and Fatty Acyl-CoA Biosynthesis. GO annotations related to this gene include transferase activity, transferring acyl groups other than amino-acyl groups and fatty acid elongase activity. An important paralog of this gene is ELOVL5.
• Molecular Mass: 61 kDa
• AA Sequence: MEHLKAFDDEINAFLDNMFGPRDSRVRGWFMLDSYLPTFFLTVMYLLSIWLGNKYMKNRPALSLRGILTLYNLGITLLSAYMLAELILSTWEGGYNLQCQDLTSAGEADIRVAKVLWWYYFSKSVEFLDTIFFVLRKKTSQITFLHVYHHASMFNIWWCVLNWIPCGQSFFGPTLNSFIHILMYSYYGLSVFPSMHKYLWWKKYLTQAQLVQFVLAITHTMSAVVKPCGFPFGCLIFQSSYMLTLVILFLNFYVQTYRKKPMKKDMQEPPAGKEVKNGFSKAYFTAANGVMNKKAQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ELOVL2 ELOVL fatty acid elongase 2 [ Homo sapiens ]
• Official Symbol: ELOVL2
• Synonyms: ELOVL2; ELOVL fatty acid elongase 2; elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast) like 2; elongation of very long chain fatty acids protein 2; Ssc2; ELOVL FA elongase 2; 3-keto acyl-CoA synthase ELOVL2; elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 2; SSC2; FLJ20334
• Gene ID: 54898
• mRNA Refseq: NM_017770
• Protein Refseq: NP_060240
• MIM: 611814
• UniProt ID: Q9NXB9