Recombinant Human ELOVL6 protein, His-tagged

• Cat.No.: ELOVL6-3775H
• Product Overview: Recombinant Human ELOVL6 protein(1-80 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-80 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALR
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: ELOVL6 ELOVL fatty acid elongase 6 [ Homo sapiens ]
• Official Symbol: ELOVL6
• Synonyms: ELOVL6; ELOVL fatty acid elongase 6; ELOVL family member 6, elongation of long chain fatty acids (FEN1/Elo2, SUR4/Elo3 like, yeast); elongation of very long chain fatty acids protein 6; FLJ23378; LCE; MGC5487; hELO2; ELOVL FA elongase 6; fatty acid elongase 2; fatty acyl-CoA elongase; long-chain fatty-acyl elongase; 3-keto acyl-CoA synthase ELOVL6; ELOVL family member 6, elongation of long chain fatty acids (FEN1/Elo2, SUR4/Elo3-like, yeast); FAE; FACE
• Gene ID: 79071
• mRNA Refseq: NM_001130721
• Protein Refseq: NP_001124193
• MIM: 611546
• UniProt ID: Q9H5J4