Recombinant Human ELOVL6 protein, His-tagged
| Cat.No. : | ELOVL6-3775H |
| Product Overview : | Recombinant Human ELOVL6 protein(1-80 aa), fused to His tag, was expressed in E. coli. |
| Availability | February 04, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-80 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALR |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | ELOVL6 ELOVL fatty acid elongase 6 [ Homo sapiens ] |
| Official Symbol | ELOVL6 |
| Synonyms | ELOVL6; ELOVL fatty acid elongase 6; ELOVL family member 6, elongation of long chain fatty acids (FEN1/Elo2, SUR4/Elo3 like, yeast); elongation of very long chain fatty acids protein 6; FLJ23378; LCE; MGC5487; hELO2; ELOVL FA elongase 6; fatty acid elongase 2; fatty acyl-CoA elongase; long-chain fatty-acyl elongase; 3-keto acyl-CoA synthase ELOVL6; ELOVL family member 6, elongation of long chain fatty acids (FEN1/Elo2, SUR4/Elo3-like, yeast); FAE; FACE; |
| Gene ID | 79071 |
| mRNA Refseq | NM_001130721 |
| Protein Refseq | NP_001124193 |
| MIM | 611546 |
| UniProt ID | Q9H5J4 |
| ◆ Recombinant Proteins | ||
| ELOVL6-1737R | Recombinant Rat ELOVL6 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ELOVL6-12422H | Recombinant Human ELOVL6, GST-tagged | +Inquiry |
| RFL26524HF | Recombinant Full Length Human Elongation Of Very Long Chain Fatty Acids Protein 6(Elovl6) Protein, His-Tagged | +Inquiry |
| ELOVL6-3775H | Recombinant Human ELOVL6 protein, His-tagged | +Inquiry |
| ELOVL6-1454R | Recombinant Rhesus monkey ELOVL6 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ELOVL6 Products
Required fields are marked with *
My Review for All ELOVL6 Products
Required fields are marked with *
