Recombinant Human ELTD1 protein, His-tagged
Cat.No. : | ELTD1-3106H |
Product Overview : | Recombinant Human ELTD1 protein(27-293 aa), fused to His tag, was expressed in E. coli. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 27-293 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | VNANCHLDNVCIAANINKTLTKIRSIKEPVALLQEVYRNSVTDLSPTDIITYIEILAESSSLLGYKNNTISAKDTLSNSTLTEFVKTVNNFVQRDTFVVWDKLSVNHRRTHLTKLMHTVEQATLRISQSFQKTTEFDTNSTDIALKVFFFDSYNMKHIHPHMNMDGDYINIFPKRKAAYDSNGNVAVAFLYYKSIGPLLSSSDNFLLKPQNYDNSEEEERVISSVISVSMSSNPPTLYELEKITFTLSHRKVTDRYRSLCAFWNYSP |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ELTD1 EGF, latrophilin and seven transmembrane domain containing 1 [ Homo sapiens ] |
Official Symbol | ELTD1 |
Synonyms | ELTD1; EGF, latrophilin and seven transmembrane domain containing 1; EGF, latrophilin and seven transmembrane domain-containing protein 1; ETL; EGF-TM7-latrophilin-related protein; KPG_003; |
Gene ID | 64123 |
mRNA Refseq | NM_022159 |
Protein Refseq | NP_071442 |
UniProt ID | Q9HBW9 |
◆ Recombinant Proteins | ||
ELTD1-5158M | Recombinant Mouse ELTD1 Protein | +Inquiry |
ELTD1-1742R | Recombinant Rat ELTD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ELTD1-3106H | Recombinant Human ELTD1 protein, His-tagged | +Inquiry |
ELTD1-2085R | Recombinant Rat ELTD1 Protein | +Inquiry |
ELTD1-2760M | Recombinant Mouse ELTD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ELTD1-6613HCL | Recombinant Human ELTD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ELTD1 Products
Required fields are marked with *
My Review for All ELTD1 Products
Required fields are marked with *