Recombinant Human EMC10 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | EMC10-4747H |
Product Overview : | C19orf63 MS Standard C13 and N15-labeled recombinant protein (NP_778233) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | EMC10 (ER Membrane Protein Complex Subunit 10) is a Protein Coding gene. Diseases associated with EMC10 include Myocardial Infarction. |
Molecular Mass : | 26.6 kDa |
AA Sequence : | MAAASAGATRLLLLLLMAVAAPSRARGSGCRAGTGARGAGAEGREGEACGTVGLLLEHSFEIDDSANFRKRGSLLWNQQDGTLSLSQRQLSEEERGRLRDVAALNGLYRVRIPRRPGALDGLEAGGYVSSFVPACSLVESHLSDQLTLHVDVAGNVVGVSVVTHPGGCRGHEVEDVDLELFNTSVQLQPPTTAPGPETAAFIERLEMEQAQKAKNPQEQKSFFAKYWHIILGGAVLLTALRPAAPGPAPPPQEATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | EMC10 ER membrane protein complex subunit 10 [ Homo sapiens (human) ] |
Official Symbol | EMC10 |
Synonyms | EMC10; ER membrane protein complex subunit 10; HSM1; HSS1; C19orf63; ER membrane protein complex subunit 10; UPF0510 protein INM02; hematopoietic signal peptide-containing membrane domain-containing 1; hematopoietic signal peptide-containing secreted 1 |
Gene ID | 284361 |
mRNA Refseq | NM_175063 |
Protein Refseq | NP_778233 |
MIM | 614545 |
UniProt ID | Q5UCC4 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EMC10 Products
Required fields are marked with *
My Review for All EMC10 Products
Required fields are marked with *
0
Inquiry Basket