Recombinant Human EMC10 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : EMC10-4747H
Product Overview : C19orf63 MS Standard C13 and N15-labeled recombinant protein (NP_778233) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : EMC10 (ER Membrane Protein Complex Subunit 10) is a Protein Coding gene. Diseases associated with EMC10 include Myocardial Infarction.
Molecular Mass : 26.6 kDa
AA Sequence : MAAASAGATRLLLLLLMAVAAPSRARGSGCRAGTGARGAGAEGREGEACGTVGLLLEHSFEIDDSANFRKRGSLLWNQQDGTLSLSQRQLSEEERGRLRDVAALNGLYRVRIPRRPGALDGLEAGGYVSSFVPACSLVESHLSDQLTLHVDVAGNVVGVSVVTHPGGCRGHEVEDVDLELFNTSVQLQPPTTAPGPETAAFIERLEMEQAQKAKNPQEQKSFFAKYWHIILGGAVLLTALRPAAPGPAPPPQEATRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name EMC10 ER membrane protein complex subunit 10 [ Homo sapiens (human) ]
Official Symbol EMC10
Synonyms EMC10; ER membrane protein complex subunit 10; HSM1; HSS1; C19orf63; ER membrane protein complex subunit 10; UPF0510 protein INM02; hematopoietic signal peptide-containing membrane domain-containing 1; hematopoietic signal peptide-containing secreted 1
Gene ID 284361
mRNA Refseq NM_175063
Protein Refseq NP_778233
MIM 614545
UniProt ID Q5UCC4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EMC10 Products

Required fields are marked with *

My Review for All EMC10 Products

Required fields are marked with *

0
cart-icon
0
compare icon