Recombinant Human EMC7 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: EMC7-615H
• Product Overview: C15orf24 MS Standard C13 and N15-labeled recombinant protein (NP_064539) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: EMC7 (ER Membrane Protein Complex Subunit 7) is a Protein Coding gene. Diseases associated with EMC7 include Cone-Rod Dystrophy, X-Linked, 1. Gene Ontology (GO) annotations related to this gene include carbohydrate binding.
• Molecular Mass: 26.5 kDa
• AA Sequence: MAAALWGFFPVLLLLLLSGDVQSSEVPGAAAEGSGGSGVGIGDRFKIEGRAVVPGVKPQDWISAARVLVDGEEHVGFLKTDGSFVVHDIPSGSYVVEVVSPAYRFDPVRVDITSKGKMRARYVNYIKTSEVVRLPYPLQMKSSGPPSYFIKRESWGWTDFLMNPMVMMMVLPLLIFVLLPKVVNTSDPDMRREMEQSMNMLNSNHELPDVSEFMTRLFSSKSSGKSSSGSSKTGKSGAGKRRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: EMC7 ER membrane protein complex subunit 7 [ Homo sapiens (human) ]
• Official Symbol: EMC7
• Synonyms: EMC7; ER membrane protein complex subunit 7; HT022; C11orf3; C15orf24; ORF1-FL1; ER membrane protein complex subunit 7; UPF0480 protein C15orf24; chromosome 15 hypothetical ATG/GTP binding protein
• Gene ID: 56851
• mRNA Refseq: NM_020154
• Protein Refseq: NP_064539
• UniProt ID: Q9NPA0