Recombinant Human EMC9 Protein (1-208 aa), His-SUMO-tagged
Cat.No. : | EMC9-1173H |
Product Overview : | Recombinant Human EMC9 Protein (1-208 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-208 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 39.1 kDa |
AA Sequence : | MGEVEISALAYVKMCLHAARYPHAAVNGLFLAPAPRSGECLCLTDCVPLFHSHLALSVMLEVALNQVDVWGAQAGLVVAGYYHANAAVNDQSPGPLALKIAGRIAEFFPDAVLIMLDNQKLVPQPRVPPVIVLENQGLRWVPKDKNLVMWRDWEESRQMVGALLEDRAHQHLVDFDCHLDDIRQDWTNQRLNTQITQWVGPTNGNGNA |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | EMC9 ER membrane protein complex subunit 9 [ Homo sapiens (human) ] |
Official Symbol | EMC9 |
Synonyms | CGI-112; FAM158A; C14orf122; |
Gene ID | 51016 |
mRNA Refseq | NM_016049 |
Protein Refseq | NP_057133 |
UniProt ID | Q9Y3B6 |
◆ Recombinant Proteins | ||
FAM158A-1578R | Recombinant Rhesus monkey FAM158A Protein, His-tagged | +Inquiry |
Emc9-2811M | Recombinant Mouse Emc9 Protein, Myc/DDK-tagged | +Inquiry |
FAM158A-2796H | Recombinant Human FAM158A protein, His-tagged | +Inquiry |
Emc9-1287R | Recombinant Rhesus Macaque Emc9 Protein, His (Fc)-Avi-tagged | +Inquiry |
EMC9-10477Z | Recombinant Zebrafish EMC9 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM158A-6419HCL | Recombinant Human FAM158A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EMC9 Products
Required fields are marked with *
My Review for All EMC9 Products
Required fields are marked with *