Recombinant Human EMC9 Protein (1-208 aa), His-SUMO-tagged

• Cat.No.: EMC9-1173H
• Product Overview: Recombinant Human EMC9 Protein (1-208 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-208 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 39.1 kDa
• AA Sequence: MGEVEISALAYVKMCLHAARYPHAAVNGLFLAPAPRSGECLCLTDCVPLFHSHLALSVMLEVALNQVDVWGAQAGLVVAGYYHANAAVNDQSPGPLALKIAGRIAEFFPDAVLIMLDNQKLVPQPRVPPVIVLENQGLRWVPKDKNLVMWRDWEESRQMVGALLEDRAHQHLVDFDCHLDDIRQDWTNQRLNTQITQWVGPTNGNGNA
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: EMC9 ER membrane protein complex subunit 9 [ Homo sapiens (human) ]
• Official Symbol: EMC9
• Synonyms: CGI-112; FAM158A; C14orf122
• Gene ID: 51016
• mRNA Refseq: NM_016049
• Protein Refseq: NP_057133
• UniProt ID: Q9Y3B6