Recombinant Human EMCN protein, GST-tagged
Cat.No. : | EMCN-42H |
Product Overview : | Recombinant Human EMCN(N-term-138aa, C-40aa) fused with GST tag was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | N-term-138aa, C-40aa |
Form : | Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 100 mM GSH, pH 8.0) and 10% glycerol. |
AA Sequence : | MELLQVTILFLLPSICSSNSTGVLEAANNSLVVTTTKPSITTPNTESLQKNVVTPTTGTTPKGTITNELLKMSLMSTATFLTSKDEGLKATTTDVRKNDSIISNVTVTSVTLPNAVSTLQSSKPKTETQSSIKTTEIPGTPENGNDQPQSDKESVKLLTVKTISHESGEHSAQGKTKN |
Storage : | Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles. |
Shipping : | The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade. |
Gene Name | EMCN endomucin [ Homo sapiens ] |
Official Symbol | EMCN |
Synonyms | EMCN; endomucin; MUC14; MUC-14; mucin-14; endomucin-2; gastric cancer antigen Ga34; EMCN2; |
Gene ID | 51705 |
mRNA Refseq | NM_001159694 |
Protein Refseq | NP_001153166 |
MIM | 608350 |
UniProt ID | Q9ULC0 |
Chromosome Location | 4q22.1 |
◆ Recombinant Proteins | ||
EMCN-2766M | Recombinant Mouse EMCN Protein, His (Fc)-Avi-tagged | +Inquiry |
EMCN-2090R | Recombinant Rat EMCN Protein | +Inquiry |
Emcn-7403M | Recombinant Mouse Emcn Protein, His-tagged | +Inquiry |
EMCN-5169M | Recombinant Mouse EMCN Protein | +Inquiry |
RFL8107RF | Recombinant Full Length Rat Endomucin(Emcn) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EMCN Products
Required fields are marked with *
My Review for All EMCN Products
Required fields are marked with *
0
Inquiry Basket