Recombinant Human EMCN protein, GST-tagged

• Cat.No.: EMCN-42H
• Product Overview: Recombinant Human EMCN(N-term-138aa, C-40aa) fused with GST tag was expressed in E. coli

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: N-term-138aa, C-40aa
• Form: Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 100 mM GSH, pH 8.0) and 10% glycerol.
• AA Sequence: MELLQVTILFLLPSICSSNSTGVLEAANNSLVVTTTKPSITTPNTESLQKNVVTPTTGTTPKGTITNELLKMSLMSTATFLTSKDEGLKATTTDVRKNDSIISNVTVTSVTLPNAVSTLQSSKPKTETQSSIKTTEIPGTPENGNDQPQSDKESVKLLTVKTISHESGEHSAQGKTKN
• Storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles.
• Shipping: The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade.

Gene Information

• Gene Name: EMCN endomucin [ Homo sapiens ]
• Official Symbol: EMCN
• Synonyms: EMCN; endomucin; MUC14; MUC-14; mucin-14; endomucin-2; gastric cancer antigen Ga34; EMCN2
• Gene ID: 51705
• mRNA Refseq: NM_001159694
• Protein Refseq: NP_001153166
• MIM: 608350
• UniProt ID: Q9ULC0
• Chromosome Location: 4q22.1