Recombinant Human EMCN protein, GST-tagged

Cat.No. : EMCN-42H
Product Overview : Recombinant Human EMCN(N-term-138aa, C-40aa) fused with GST tag was expressed in E. coli
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : N-term-138aa, C-40aa
Form : Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 100 mM GSH, pH 8.0) and 10% glycerol.
AA Sequence : MELLQVTILFLLPSICSSNSTGVLEAANNSLVVTTTKPSITTPNTESLQKNVVTPTTGTTPKGTITNELLKMSLMSTATFLTSKDEGLKATTTDVRKNDSIISNVTVTSVTLPNAVSTLQSSKPKTETQSSIKTTEIPGTPENGNDQPQSDKESVKLLTVKTISHESGEHSAQGKTKN
Storage : Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles.
Shipping : The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade.
Gene Name EMCN endomucin [ Homo sapiens ]
Official Symbol EMCN
Synonyms EMCN; endomucin; MUC14; MUC-14; mucin-14; endomucin-2; gastric cancer antigen Ga34; EMCN2;
Gene ID 51705
mRNA Refseq NM_001159694
Protein Refseq NP_001153166
MIM 608350
UniProt ID Q9ULC0
Chromosome Location 4q22.1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EMCN Products

Required fields are marked with *

My Review for All EMCN Products

Required fields are marked with *

0
cart-icon
0
compare icon