Recombinant Human EMID2 Protein, GST-tagged
Cat.No. : | EMID2-3278H |
Product Overview : | Human EMID2 partial ORF ( NP_597714, 380 a.a. - 440 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein containing an emilin domain and two collagen stretches. This gene may be associated with aspirin-intolerant asthma. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2013] |
Molecular Mass : | 32.45 kDa |
AA Sequence : | ILEHMIGIHDPLASPEGGSGQDAALRANLKMKRGGAQPDGVLAALLGPDPGQKSVDQASSR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EMID2 EMI domain containing 2 [ Homo sapiens ] |
Official Symbol | EMID2 |
Synonyms | EMID2; EMI domain containing 2; COL26A1, collagen, type XXVI, alpha 1; collagen alpha-1(XXVI) chain; EMI6; Emu2; Emu2 gene; putative emu2; collagen, type XXVI, alpha 1; emilin and multimerin domain-containing protein 2; EMU2; SH2B; COL26A1; MGC129848; |
Gene ID | 136227 |
mRNA Refseq | NM_133457 |
Protein Refseq | NP_597714 |
MIM | 608927 |
UniProt ID | Q96A83 |
◆ Recombinant Proteins | ||
EMID2-5175M | Recombinant Mouse EMID2 Protein | +Inquiry |
EMID2-3278H | Recombinant Human EMID2 Protein, GST-tagged | +Inquiry |
EMID2-2771M | Recombinant Mouse EMID2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EMID2 Products
Required fields are marked with *
My Review for All EMID2 Products
Required fields are marked with *