Recombinant Human EMID2 Protein, GST-tagged

Cat.No. : EMID2-3278H
Product Overview : Human EMID2 partial ORF ( NP_597714, 380 a.a. - 440 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein containing an emilin domain and two collagen stretches. This gene may be associated with aspirin-intolerant asthma. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2013]
Molecular Mass : 32.45 kDa
AA Sequence : ILEHMIGIHDPLASPEGGSGQDAALRANLKMKRGGAQPDGVLAALLGPDPGQKSVDQASSR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EMID2 EMI domain containing 2 [ Homo sapiens ]
Official Symbol EMID2
Synonyms EMID2; EMI domain containing 2; COL26A1, collagen, type XXVI, alpha 1; collagen alpha-1(XXVI) chain; EMI6; Emu2; Emu2 gene; putative emu2; collagen, type XXVI, alpha 1; emilin and multimerin domain-containing protein 2; EMU2; SH2B; COL26A1; MGC129848;
Gene ID 136227
mRNA Refseq NM_133457
Protein Refseq NP_597714
MIM 608927
UniProt ID Q96A83

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EMID2 Products

Required fields are marked with *

My Review for All EMID2 Products

Required fields are marked with *

0
cart-icon
0
compare icon