Recombinant Human EMP1 Protein, GST-tagged
| Cat.No. : | EMP1-3286H |
| Product Overview : | Human EMP1 full-length ORF ( AAH47300, 1 a.a. - 157 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | EMP1 (Epithelial Membrane Protein 1) is a Protein Coding gene. Diseases associated with EMP1 include Endobronchial Lipoma. An important paralog of this gene is EMP2. |
| Molecular Mass : | 43.01 kDa |
| AA Sequence : | MLVLLAGIFVVHIATVIMLFVSTIANVWLVSNTVDASVGLWKNCTNISCSDSLSYASEDALKTVQAFMILSIIFCVIALLVFVFQLFTMEKGNRFFLSGATTLVCWLCILVGVSIYTSHYANRDGTQYHHGYSYILGWICFCFSFIIGVLYLVLRKK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | EMP1 epithelial membrane protein 1 [ Homo sapiens ] |
| Official Symbol | EMP1 |
| Synonyms | epithelial membrane protein 1; 3333; Ensembl:ENSG00000134531; epithelial membrane protein 1;tumor-associated membrane protein; TMP; CL-20; EMP-1 |
| Gene ID | 2012 |
| mRNA Refseq | NM_001423 |
| Protein Refseq | NP_001414 |
| MIM | 602333 |
| UniProt ID | P54849 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EMP1 Products
Required fields are marked with *
My Review for All EMP1 Products
Required fields are marked with *
