Recombinant Human EMP1 Protein, GST-tagged
Cat.No. : | EMP1-3286H |
Product Overview : | Human EMP1 full-length ORF ( AAH47300, 1 a.a. - 157 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | EMP1 (Epithelial Membrane Protein 1) is a Protein Coding gene. Diseases associated with EMP1 include Endobronchial Lipoma. An important paralog of this gene is EMP2. |
Molecular Mass : | 43.01 kDa |
AA Sequence : | MLVLLAGIFVVHIATVIMLFVSTIANVWLVSNTVDASVGLWKNCTNISCSDSLSYASEDALKTVQAFMILSIIFCVIALLVFVFQLFTMEKGNRFFLSGATTLVCWLCILVGVSIYTSHYANRDGTQYHHGYSYILGWICFCFSFIIGVLYLVLRKK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EMP1 epithelial membrane protein 1 [ Homo sapiens ] |
Official Symbol | EMP1 |
Synonyms | epithelial membrane protein 1; 3333; Ensembl:ENSG00000134531; epithelial membrane protein 1;tumor-associated membrane protein; TMP; CL-20; EMP-1 |
Gene ID | 2012 |
mRNA Refseq | NM_001423 |
Protein Refseq | NP_001414 |
MIM | 602333 |
UniProt ID | P54849 |
◆ Recombinant Proteins | ||
EMP1-5184M | Recombinant Mouse EMP1 Protein | +Inquiry |
Emp1-2815M | Recombinant Mouse Emp1 Protein, Myc/DDK-tagged | +Inquiry |
RFL2658MF | Recombinant Full Length Mouse Epithelial Membrane Protein 1(Emp1) Protein, His-Tagged | +Inquiry |
EMP1-1460HFL | Recombinant Full Length Human EMP1 Protein, C-Flag-tagged | +Inquiry |
EMP1-12441H | Recombinant Human EMP1, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EMP1-6607HCL | Recombinant Human EMP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EMP1 Products
Required fields are marked with *
My Review for All EMP1 Products
Required fields are marked with *