Recombinant Human EMP3
| Cat.No. : | EMP3-28552TH |
| Product Overview : | Recombinant fragment of Human EMP3 with N-terminal proprietary tag. Predicted MW 30.47 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 44 amino acids |
| Description : | Epithelial membrane protein 3 is a protein that in humans is encoded by the EMP3 gene. |
| Molecular Weight : | 30.470kDa |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | DKSWWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGWLKAVQV |
| Sequence Similarities : | Belongs to the PMP-22/EMP/MP20 family. |
| Gene Name | EMP3 epithelial membrane protein 3 [ Homo sapiens ] |
| Official Symbol | EMP3 |
| Synonyms | EMP3; epithelial membrane protein 3; YMP; |
| Gene ID | 2014 |
| mRNA Refseq | NM_001425 |
| Protein Refseq | NP_001416 |
| MIM | 602335 |
| Uniprot ID | P54852 |
| Chromosome Location | 19q13.3 |
| ◆ Recombinant Proteins | ||
| EMP3-2780M | Recombinant Mouse EMP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| EMP3-1292R | Recombinant Rhesus Macaque EMP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| EMP3-28552TH | Recombinant Human EMP3 | +Inquiry |
| EMP3-1753R | Recombinant Rat EMP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| EMP3-3288H | Recombinant Human EMP3 Protein, GST-tagged | +Inquiry |
| ◆ Native Proteins | ||
| EMP3-20HFL | Recombinant Full Length Human EMP3 Protein, Flag tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EMP3-6605HCL | Recombinant Human EMP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EMP3 Products
Required fields are marked with *
My Review for All EMP3 Products
Required fields are marked with *
