Recombinant Human EMP3
Cat.No. : | EMP3-28552TH |
Product Overview : | Recombinant fragment of Human EMP3 with N-terminal proprietary tag. Predicted MW 30.47 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 44 amino acids |
Description : | Epithelial membrane protein 3 is a protein that in humans is encoded by the EMP3 gene. |
Molecular Weight : | 30.470kDa |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | DKSWWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGWLKAVQV |
Sequence Similarities : | Belongs to the PMP-22/EMP/MP20 family. |
Gene Name | EMP3 epithelial membrane protein 3 [ Homo sapiens ] |
Official Symbol | EMP3 |
Synonyms | EMP3; epithelial membrane protein 3; YMP; |
Gene ID | 2014 |
mRNA Refseq | NM_001425 |
Protein Refseq | NP_001416 |
MIM | 602335 |
Uniprot ID | P54852 |
Chromosome Location | 19q13.3 |
◆ Recombinant Proteins | ||
Emp3-2817M | Recombinant Mouse Emp3 Protein, Myc/DDK-tagged | +Inquiry |
EMP3-5186M | Recombinant Mouse EMP3 Protein | +Inquiry |
EMP3-1753R | Recombinant Rat EMP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL32256RF | Recombinant Full Length Rat Epithelial Membrane Protein 3(Emp3) Protein, His-Tagged | +Inquiry |
EMP3-3288H | Recombinant Human EMP3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EMP3-6605HCL | Recombinant Human EMP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EMP3 Products
Required fields are marked with *
My Review for All EMP3 Products
Required fields are marked with *