Recombinant Human EMX1 Protein, GST-tagged
| Cat.No. : | EMX1-3295H |
| Product Overview : | Human EMX1 full-length ORF (AAH45762.2, 1 a.a. - 257 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | EMX1 (Empty Spiracles Homeobox 1) is a Protein Coding gene. Diseases associated with EMX1 include Kallmann Syndrome. GO annotations related to this gene include sequence-specific DNA binding. An important paralog of this gene is EMX2. |
| Molecular Mass : | 54.67 kDa |
| AA Sequence : | MFQPAAKRGFTIESLVAKDGGTGGGTGGGGAGSHLLAAAASEEPLRPTALNYPHPSAAEAAFVSGFPAAAAAGAGRSLYGGPELVFPEAMNHPALTVHPAHQLGASPLQPPHSFFGAQHRDPLHFYPWVLRNRFFGHRFQASDVPQDGLLLHGPFARKPKRIRTAFSPSQLLRLERAFEKNHYVVGAERKQLAGSLSLSETQVKVWFQNRRTKYKRQKLEEEGPESEQKKKGSHHINRWRIATKQANGEDIDVTSND |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | EMX1 empty spiracles homeobox 1 [ Homo sapiens ] |
| Official Symbol | EMX1 |
| Synonyms | EMX1; empty spiracles homeobox 1; empty spiracles homolog 1 (Drosophila); homeobox protein EMX1; empty spiracles homolog 1; empty spiracles-like protein 1; |
| Gene ID | 2016 |
| mRNA Refseq | NM_004097 |
| Protein Refseq | NP_004088 |
| MIM | 600034 |
| UniProt ID | Q04741 |
| ◆ Recombinant Proteins | ||
| EMX1-1468R | Recombinant Rhesus monkey EMX1 Protein, His-tagged | +Inquiry |
| EMX1-9800Z | Recombinant Zebrafish EMX1 | +Inquiry |
| EMX1-5189M | Recombinant Mouse EMX1 Protein | +Inquiry |
| EMX1-1293R | Recombinant Rhesus Macaque EMX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| EMX1-4280HF | Recombinant Full Length Human EMX1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EMX1 Products
Required fields are marked with *
My Review for All EMX1 Products
Required fields are marked with *
