Recombinant Human EMX1 Protein, GST-tagged

Cat.No. : EMX1-3295H
Product Overview : Human EMX1 full-length ORF (AAH45762.2, 1 a.a. - 257 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : EMX1 (Empty Spiracles Homeobox 1) is a Protein Coding gene. Diseases associated with EMX1 include Kallmann Syndrome. GO annotations related to this gene include sequence-specific DNA binding. An important paralog of this gene is EMX2.
Molecular Mass : 54.67 kDa
AA Sequence : MFQPAAKRGFTIESLVAKDGGTGGGTGGGGAGSHLLAAAASEEPLRPTALNYPHPSAAEAAFVSGFPAAAAAGAGRSLYGGPELVFPEAMNHPALTVHPAHQLGASPLQPPHSFFGAQHRDPLHFYPWVLRNRFFGHRFQASDVPQDGLLLHGPFARKPKRIRTAFSPSQLLRLERAFEKNHYVVGAERKQLAGSLSLSETQVKVWFQNRRTKYKRQKLEEEGPESEQKKKGSHHINRWRIATKQANGEDIDVTSND
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EMX1 empty spiracles homeobox 1 [ Homo sapiens ]
Official Symbol EMX1
Synonyms EMX1; empty spiracles homeobox 1; empty spiracles homolog 1 (Drosophila); homeobox protein EMX1; empty spiracles homolog 1; empty spiracles-like protein 1;
Gene ID 2016
mRNA Refseq NM_004097
Protein Refseq NP_004088
MIM 600034
UniProt ID Q04741

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EMX1 Products

Required fields are marked with *

My Review for All EMX1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon