Recombinant Human ENGASE Protein (1-377 aa), His-SUMO-tagged
Cat.No. : | ENGASE-2407H |
Product Overview : | Recombinant Human ENGASE Protein (1-377 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-377 aa |
Description : | Endoglycosidase that releases N-glycans from glycoproteins by cleaving the beta-1,4-glycosidic bond in the N,N'-diacetylchitobiose core. Involved in the processing of free oligosaccharides in the cytosol. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 59.1 kDa |
AA Sequence : | MEAAAVTVTRSATRRRRRQLQGLAAPEAGTQEEQEDQEPRPRRRRPGRSIKDEEEETVFREVVSFSPDPLPVRYYDKDTTKPISFYLSSLEELLAWKPRLEDGFNVALEPLACRQPPLSSQRPRTLLCHDMMGGYLDDRFIQGSVVQTPYAFYHWQCIDVFVYFSHHTVTIPPVGWTNTAHRHGVCVLGTFITEWNEGGRLCEAFLAGDERSYQAVADRLVQITQFFRFDGWLINIENSLSLAAVGNMPPFLRYLTTQLHRQVPGGLVLWYDSVVQSGQLKWQDELNQHNRVFFDSCDGFFTNYNWREEHLERMLGQAGERRADVYVGVDVFARGNVVGGRFDTDKSLELIRKHGFSVALFAPSCSVFPGVGNLLCC |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | ENGASE endo-beta-N-acetylglucosaminidase [ Homo sapiens ] |
Official Symbol | ENGASE |
Synonyms | ENGASE; |
Gene ID | 64772 |
mRNA Refseq | NM_001042573.2 |
Protein Refseq | NP_001036038.1 |
MIM | 611898 |
UniProt ID | Q8NFI3 |
◆ Recombinant Proteins | ||
ENGASE-1099H | Recombinant Human ENGASE | +Inquiry |
ENGASE-5075Z | Recombinant Zebrafish ENGASE | +Inquiry |
ENGASE-841H | Recombinant Human ENGASE Protein, His (Fc)-Avi-tagged | +Inquiry |
Engase-2824M | Recombinant Mouse Engase Protein, Myc/DDK-tagged | +Inquiry |
ENGASE-2407H | Recombinant Human ENGASE Protein (1-377 aa), His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ENGASE Products
Required fields are marked with *
My Review for All ENGASE Products
Required fields are marked with *
0
Inquiry Basket