Recombinant Mouse Enho protein, His-KSI-tagged
Cat.No. : | Enho-5632M |
Product Overview : | Recombinant Mouse Enho protein(Q8K1D8)(34-76aa), fused with N-terminal His and KSI tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&KSI |
Protein Length : | 34-76aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 19.8 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | CHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQP |
◆ Recombinant Proteins | ||
ENHO-4300HF | Recombinant Full Length Human ENHO Protein, GST-tagged | +Inquiry |
ENHO-2744H | Recombinant Human ENHO Protein, His&SUMO-tagged | +Inquiry |
ENHO-2807H | Recombinant Human ENHO Protein, His-tagged, OVA Conjugated | +Inquiry |
ENHO-3227B | Recombinant Bovine ENHO, GST-tagged | +Inquiry |
ENHO-1297R | Recombinant Rhesus Macaque ENHO Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ENHO-6601HCL | Recombinant Human ENHO 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Enho Products
Required fields are marked with *
My Review for All Enho Products
Required fields are marked with *