Recombinant Human ENHO Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ENHO-5359H
Product Overview : ENHO MS Standard C13 and N15-labeled recombinant protein (NP_940975) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : ENHO (Energy Homeostasis Associated) is a Protein Coding gene.
Molecular Mass : 7.7 kDa
AA Sequence : MGAAISQGALIAIVCNGLVGFLLLLLWVILCWACHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ENHO energy homeostasis associated [ Homo sapiens (human) ]
Official Symbol ENHO
Synonyms ENHO; energy homeostasis associated; UNQ470; C9orf165; adropin; GAAI470; energy homeostasis-associated protein
Gene ID 375704
mRNA Refseq NM_198573
Protein Refseq NP_940975
MIM 618556
UniProt ID Q6UWT2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ENHO Products

Required fields are marked with *

My Review for All ENHO Products

Required fields are marked with *

0

Inquiry Basket

cartIcon