Recombinant Human ENHO Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ENHO-5359H |
Product Overview : | ENHO MS Standard C13 and N15-labeled recombinant protein (NP_940975) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | ENHO (Energy Homeostasis Associated) is a Protein Coding gene. |
Molecular Mass : | 7.7 kDa |
AA Sequence : | MGAAISQGALIAIVCNGLVGFLLLLLWVILCWACHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ENHO energy homeostasis associated [ Homo sapiens (human) ] |
Official Symbol | ENHO |
Synonyms | ENHO; energy homeostasis associated; UNQ470; C9orf165; adropin; GAAI470; energy homeostasis-associated protein |
Gene ID | 375704 |
mRNA Refseq | NM_198573 |
Protein Refseq | NP_940975 |
MIM | 618556 |
UniProt ID | Q6UWT2 |
◆ Recombinant Proteins | ||
ENHO-5661C | Recombinant Chicken ENHO | +Inquiry |
ENHO-1297R | Recombinant Rhesus Macaque ENHO Protein, His (Fc)-Avi-tagged | +Inquiry |
ENHO-2744H | Recombinant Human ENHO Protein, His&SUMO-tagged | +Inquiry |
ENHO-1472R | Recombinant Rhesus monkey ENHO Protein, His-tagged | +Inquiry |
Enho-1760M | Recombinant Mouse Enho protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ENHO-6601HCL | Recombinant Human ENHO 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ENHO Products
Required fields are marked with *
My Review for All ENHO Products
Required fields are marked with *
0
Inquiry Basket