Recombinant Human ENHO Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | ENHO-5359H |
| Product Overview : | ENHO MS Standard C13 and N15-labeled recombinant protein (NP_940975) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | ENHO (Energy Homeostasis Associated) is a Protein Coding gene. |
| Molecular Mass : | 7.7 kDa |
| AA Sequence : | MGAAISQGALIAIVCNGLVGFLLLLLWVILCWACHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | ENHO energy homeostasis associated [ Homo sapiens (human) ] |
| Official Symbol | ENHO |
| Synonyms | ENHO; energy homeostasis associated; UNQ470; C9orf165; adropin; GAAI470; energy homeostasis-associated protein |
| Gene ID | 375704 |
| mRNA Refseq | NM_198573 |
| Protein Refseq | NP_940975 |
| MIM | 618556 |
| UniProt ID | Q6UWT2 |
| ◆ Recombinant Proteins | ||
| ENHO-1297R | Recombinant Rhesus Macaque ENHO Protein, His (Fc)-Avi-tagged | +Inquiry |
| ENHO-5359H | Recombinant Human ENHO Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ENHO-3705H | Recombinant Human ENHO Protein (Cys34-Pro76), N-GST tagged | +Inquiry |
| ENHO-2744H | Recombinant Human ENHO Protein, His&SUMO-tagged | +Inquiry |
| ENHO-2807H | Recombinant Human ENHO Protein, His-tagged, OVA Conjugated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ENHO-6601HCL | Recombinant Human ENHO 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ENHO Products
Required fields are marked with *
My Review for All ENHO Products
Required fields are marked with *




