Recombinant Human ENOSF1 protein, T7-tagged
Cat.No. : | ENOSF1-161H |
Product Overview : | Recombinant human ENOSF1 (443aa) fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Protein Length : | 443 a.a. |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGEFMVRGRISRLSVRDVRFPTSLGGHGADAMHTDPDYSAAYVVIETDAEDGIKGCGITFTLGK GTEVVVCAVNALAHHVLNKDLKDIVGDFRGFYRQLTSDGQLRWIGPEKGVVHLATAAVLNAVWDLWAKQEGKPVW KLLVDMDPRMLVSCIDFRYITDVLTEEDALEILQKGQIGKKEREKQMLAQGYPAYTTSCAWLGYSDDTLKQLCAQ ALKDGWTRFKVKVGADLQDDMRRCQIIRDMIGPEKTLMMDANQRWDVPEAVEWMSKLAKFKPLWIEEPTSPDDIL GHATISKALVPLGIGIATGEQCHNRVIFKQLLQAKALQFLQIDSCRLGSVNENLSVLLMAKKFEIPVCPHAGGVG LCELVQHLIIFDYISVSASLENRVCEYVDHLHEHFKYPVMIQRASYMPPKDPGYSTEMKEESVKKHQYPDGEVWK KLLPAQEN |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro methionine metabolism pathway regulation study with recombinant ENOSF1 protein intracellular delivery methods2. As soluble/native protein, may be used as enzymatic substrate protein for ubiquitin assay.3. May be used for mapping protein–protein interaction assay.4. May be used as antigen for specific antibody development. |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | ENOSF1 enolase superfamily member 1 [ Homo sapiens ] |
Official Symbol | ENOSF1 |
Synonyms | ENOSF1; enolase superfamily member 1; mitochondrial enolase superfamily member 1; HSRTSBETA; rTS; TYMSAS; rTS beta; rTS alpha; antisense RNA to thymidylate synthase; RTS; |
Gene ID | 55556 |
mRNA Refseq | NM_001126123 |
Protein Refseq | NP_001119595 |
MIM | 607427 |
UniProt ID | Q7L5Y1 |
Chromosome Location | 18p11.32 |
Function | isomerase activity; metal ion binding; molecular_function; |
◆ Recombinant Proteins | ||
ENOSF1-2971H | Recombinant Human ENOSF1, T7-tagged | +Inquiry |
ENOSF1-161H | Recombinant Human ENOSF1 protein, T7-tagged | +Inquiry |
ENOSF1-4578Z | Recombinant Zebrafish ENOSF1 | +Inquiry |
ENOSF1-3318H | Recombinant Human ENOSF1 Protein, GST-tagged | +Inquiry |
ENOSF1-4308HF | Recombinant Full Length Human ENOSF1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ENOSF1 Products
Required fields are marked with *
My Review for All ENOSF1 Products
Required fields are marked with *
0
Inquiry Basket