Recombinant Human ENOSF1 protein, T7-tagged

Cat.No. : ENOSF1-161H
Product Overview : Recombinant human ENOSF1 (443aa) fused with T7 Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : T7
Protein Length : 443 a.a.
Form : 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGEFMVRGRISRLSVRDVRFPTSLGGHGADAMHTDPDYSAAYVVIETDAEDGIKGCGITFTLGK GTEVVVCAVNALAHHVLNKDLKDIVGDFRGFYRQLTSDGQLRWIGPEKGVVHLATAAVLNAVWDLWAKQEGKPVW KLLVDMDPRMLVSCIDFRYITDVLTEEDALEILQKGQIGKKEREKQMLAQGYPAYTTSCAWLGYSDDTLKQLCAQ ALKDGWTRFKVKVGADLQDDMRRCQIIRDMIGPEKTLMMDANQRWDVPEAVEWMSKLAKFKPLWIEEPTSPDDIL GHATISKALVPLGIGIATGEQCHNRVIFKQLLQAKALQFLQIDSCRLGSVNENLSVLLMAKKFEIPVCPHAGGVG LCELVQHLIIFDYISVSASLENRVCEYVDHLHEHFKYPVMIQRASYMPPKDPGYSTEMKEESVKKHQYPDGEVWK KLLPAQEN
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro methionine metabolism pathway regulation study with recombinant ENOSF1 protein intracellular delivery methods2. As soluble/native protein, may be used as enzymatic substrate protein for ubiquitin assay.3. May be used for mapping protein–protein interaction assay.4. May be used as antigen for specific antibody development.
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name ENOSF1 enolase superfamily member 1 [ Homo sapiens ]
Official Symbol ENOSF1
Synonyms ENOSF1; enolase superfamily member 1; mitochondrial enolase superfamily member 1; HSRTSBETA; rTS; TYMSAS; rTS beta; rTS alpha; antisense RNA to thymidylate synthase; RTS;
Gene ID 55556
mRNA Refseq NM_001126123
Protein Refseq NP_001119595
MIM 607427
UniProt ID Q7L5Y1
Chromosome Location 18p11.32
Function isomerase activity; metal ion binding; molecular_function;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ENOSF1 Products

Required fields are marked with *

My Review for All ENOSF1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon