Recombinant Human ENPP2 protein, His-tagged
Cat.No. : | ENPP2-3410H |
Product Overview : | Recombinant Human ENPP2 protein(30-383 aa), fused to His tag, was expressed in E. coli. |
Availability | October 06, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 30-383 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | AHRIKRAEGWEEGPPTVLSDSPWTNISGSCKGRCFELQEAGPPDCRCDNLCKSYTSCCHDFDELCLKTARGWECTKDRCGEVRNEENACHCSEDCLARGDCCTNYQVVCKGESHWVDDDCEEIKAAECPAGFVRPPLIIFSVDGFRASYMKKGSKVMPNIEKLRSCGTHSPYMRPVYPTKTFPNLYTLATGLYPESHGIVGNSMYDPVFDATFHLRGREKFNHRWWGGQPLWITATKQGVKAGTFFWSVVIPHERRILTILQWLTLPDHERPSVYAFYSEQPDFSGHKYGPFGPEMTNPLREIDKIVGQLMDGLKQLKLHRCVNVIFVGDHGMEDVTCDRTEFLSNYLTNVDDI |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ENPP2 ectonucleotide pyrophosphatase/phosphodiesterase 2 [ Homo sapiens ] |
Official Symbol | ENPP2 |
Synonyms | ENPP2; ectonucleotide pyrophosphatase/phosphodiesterase 2; PDNP2; ectonucleotide pyrophosphatase/phosphodiesterase family member 2; ATX; autotaxin; PD IALPHA; E-NPP 2; autotaxin-t; plasma lysophospholipase D; extracellular lysophospholipase D; phosphodiesterase I/nucleotide pyrophosphatase 2; NPP2; ATX-X; LysoPLD; AUTOTAXIN; PD-IALPHA; FLJ26803; |
Gene ID | 5168 |
mRNA Refseq | NM_001040092 |
Protein Refseq | NP_001035181 |
MIM | 601060 |
UniProt ID | Q13822 |
◆ Recombinant Proteins | ||
ENPP2-3410H | Recombinant Human ENPP2 protein, His-tagged | +Inquiry |
ENPP2-794H | Recombinant Human ENPP2 Protein | +Inquiry |
ENPP2-013H | Recombinant Human ENPP2 Protein, His-tagged | +Inquiry |
ENPP2-552H | Recombinant Human ENPP2 Protein, His-tagged | +Inquiry |
ENPP2-2667H | Recombinant Human ENPP2 Protein (Ser637-Ile863), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ENPP2-1556HCL | Recombinant Human ENPP2 cell lysate | +Inquiry |
ENPP2-1939MCL | Recombinant Mouse ENPP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ENPP2 Products
Required fields are marked with *
My Review for All ENPP2 Products
Required fields are marked with *