Recombinant Human ENTPD5 Protein, GST-tagged
| Cat.No. : | ENTPD5-3337H |
| Product Overview : | Human ENTPD5 full-length ORF ( AAH20966, 1 a.a. - 407 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is similar to E-type nucleotidases (NTPases)/ecto-ATPase/apyrases. NTPases, such as CD39, mediate catabolism of extracellular nucleotides. ENTPD5 contains 4 apyrase-conserved regions which is characteristic of NTPases. [provided by RefSeq, Jan 2009] |
| Molecular Mass : | 70.18 kDa |
| AA Sequence : | MATSWGTVFFMLVVSCVCSAVSHRNQQTWFEGIFLSSMCPINVSASTLYGIMFDAGSTGTRIHVYTFVQKMPGQLPILEGEVFDSVKPGLSAFVDQPKQGAETVQGLLEVAKDSIPRSHWKKTPVVLKATAGLRLLPEHKAKALLFEVKEIFRKSPFLVPKGSVSIMDGSDEGILAWVTVNFLTGQLHGHRQETVGTLDLGGASTQITFLPQFEKTLEQTPRGYLTSFEMFNSTYKLYTHSYLGFGLKAARLATLGALETEGTDGHTFRSACLPRWLEAEWIFGGVKYQYGGNQEGEVGFEPCYAEVLRVVRGKLHQPEEVQRGSFYAFSYYYDRAVDTDMIDYEKGGILKVEDFERKAREVCDNLENFTSGSPFLCMDLSYITALLKDGFGFADSTVLQHIISWVN |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ENTPD5 ectonucleoside triphosphate diphosphohydrolase 5 [ Homo sapiens ] |
| Official Symbol | ENTPD5 |
| Synonyms | ENTPD5; ectonucleoside triphosphate diphosphohydrolase 5; CD39L4, PCPH, proto oncogene CPH; NTPDase 5; ER-UDPase; CD39-like 4; GDPase ENTPD5; UDPase ENTPD5; proto-oncogene CPH; CD39 antigen-like 4; nucleoside diphosphatase; Pcph proto-oncogene protein; uridine-diphosphatase ENTPD5; guanosine-diphosphatase ENTPD5; PCPH; CD39L4; NTPDase-5; MGC163357; MGC163359; |
| Gene ID | 957 |
| mRNA Refseq | NM_001249 |
| Protein Refseq | NP_001240 |
| MIM | 603162 |
| UniProt ID | O75356 |
| ◆ Recombinant Proteins | ||
| ENTPD5-1575HFL | Recombinant Full Length Human ENTPD5 Protein, C-Flag-tagged | +Inquiry |
| RFL7577AF | Recombinant Full Length Ailuropoda Melanoleuca Ectonucleoside Triphosphate Diphosphohydrolase 5(Entpd5) Protein, His-Tagged | +Inquiry |
| ENTPD5-551M | Recombinant Mouse Entpd5, His tagged | +Inquiry |
| ENTPD5-849H | Recombinant Human ENTPD5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ENTPD5-4334HF | Recombinant Full Length Human ENTPD5 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ENTPD5-001MCL | Recombinant Mouse ENTPD5 cell lysate | +Inquiry |
| ENTPD5-451HCL | Recombinant Human ENTPD5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ENTPD5 Products
Required fields are marked with *
My Review for All ENTPD5 Products
Required fields are marked with *
