Recombinant Human ENTPD5 Protein, GST-tagged
Cat.No. : | ENTPD5-3337H |
Product Overview : | Human ENTPD5 full-length ORF ( AAH20966, 1 a.a. - 407 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is similar to E-type nucleotidases (NTPases)/ecto-ATPase/apyrases. NTPases, such as CD39, mediate catabolism of extracellular nucleotides. ENTPD5 contains 4 apyrase-conserved regions which is characteristic of NTPases. [provided by RefSeq, Jan 2009] |
Molecular Mass : | 70.18 kDa |
AA Sequence : | MATSWGTVFFMLVVSCVCSAVSHRNQQTWFEGIFLSSMCPINVSASTLYGIMFDAGSTGTRIHVYTFVQKMPGQLPILEGEVFDSVKPGLSAFVDQPKQGAETVQGLLEVAKDSIPRSHWKKTPVVLKATAGLRLLPEHKAKALLFEVKEIFRKSPFLVPKGSVSIMDGSDEGILAWVTVNFLTGQLHGHRQETVGTLDLGGASTQITFLPQFEKTLEQTPRGYLTSFEMFNSTYKLYTHSYLGFGLKAARLATLGALETEGTDGHTFRSACLPRWLEAEWIFGGVKYQYGGNQEGEVGFEPCYAEVLRVVRGKLHQPEEVQRGSFYAFSYYYDRAVDTDMIDYEKGGILKVEDFERKAREVCDNLENFTSGSPFLCMDLSYITALLKDGFGFADSTVLQHIISWVN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ENTPD5 ectonucleoside triphosphate diphosphohydrolase 5 [ Homo sapiens ] |
Official Symbol | ENTPD5 |
Synonyms | ENTPD5; ectonucleoside triphosphate diphosphohydrolase 5; CD39L4, PCPH, proto oncogene CPH; NTPDase 5; ER-UDPase; CD39-like 4; GDPase ENTPD5; UDPase ENTPD5; proto-oncogene CPH; CD39 antigen-like 4; nucleoside diphosphatase; Pcph proto-oncogene protein; uridine-diphosphatase ENTPD5; guanosine-diphosphatase ENTPD5; PCPH; CD39L4; NTPDase-5; MGC163357; MGC163359; |
Gene ID | 957 |
mRNA Refseq | NM_001249 |
Protein Refseq | NP_001240 |
MIM | 603162 |
UniProt ID | O75356 |
◆ Recombinant Proteins | ||
ENTPD5-3337H | Recombinant Human ENTPD5 Protein, GST-tagged | +Inquiry |
ENTPD5-4334HF | Recombinant Full Length Human ENTPD5 Protein, GST-tagged | +Inquiry |
ENTPD5-2111R | Recombinant Rat ENTPD5 Protein | +Inquiry |
ENTPD5-849H | Recombinant Human ENTPD5 Protein, His (Fc)-Avi-tagged | +Inquiry |
ENTPD5-1034H | Active Recombinant Human ENTPD5 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ENTPD5-001MCL | Recombinant Mouse ENTPD5 cell lysate | +Inquiry |
ENTPD5-451HCL | Recombinant Human ENTPD5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ENTPD5 Products
Required fields are marked with *
My Review for All ENTPD5 Products
Required fields are marked with *