Recombinant Human ENTPD5 Protein, GST-tagged

Cat.No. : ENTPD5-3337H
Product Overview : Human ENTPD5 full-length ORF ( AAH20966, 1 a.a. - 407 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is similar to E-type nucleotidases (NTPases)/ecto-ATPase/apyrases. NTPases, such as CD39, mediate catabolism of extracellular nucleotides. ENTPD5 contains 4 apyrase-conserved regions which is characteristic of NTPases. [provided by RefSeq, Jan 2009]
Molecular Mass : 70.18 kDa
AA Sequence : MATSWGTVFFMLVVSCVCSAVSHRNQQTWFEGIFLSSMCPINVSASTLYGIMFDAGSTGTRIHVYTFVQKMPGQLPILEGEVFDSVKPGLSAFVDQPKQGAETVQGLLEVAKDSIPRSHWKKTPVVLKATAGLRLLPEHKAKALLFEVKEIFRKSPFLVPKGSVSIMDGSDEGILAWVTVNFLTGQLHGHRQETVGTLDLGGASTQITFLPQFEKTLEQTPRGYLTSFEMFNSTYKLYTHSYLGFGLKAARLATLGALETEGTDGHTFRSACLPRWLEAEWIFGGVKYQYGGNQEGEVGFEPCYAEVLRVVRGKLHQPEEVQRGSFYAFSYYYDRAVDTDMIDYEKGGILKVEDFERKAREVCDNLENFTSGSPFLCMDLSYITALLKDGFGFADSTVLQHIISWVN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ENTPD5 ectonucleoside triphosphate diphosphohydrolase 5 [ Homo sapiens ]
Official Symbol ENTPD5
Synonyms ENTPD5; ectonucleoside triphosphate diphosphohydrolase 5; CD39L4, PCPH, proto oncogene CPH; NTPDase 5; ER-UDPase; CD39-like 4; GDPase ENTPD5; UDPase ENTPD5; proto-oncogene CPH; CD39 antigen-like 4; nucleoside diphosphatase; Pcph proto-oncogene protein; uridine-diphosphatase ENTPD5; guanosine-diphosphatase ENTPD5; PCPH; CD39L4; NTPDase-5; MGC163357; MGC163359;
Gene ID 957
mRNA Refseq NM_001249
Protein Refseq NP_001240
MIM 603162
UniProt ID O75356

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ENTPD5 Products

Required fields are marked with *

My Review for All ENTPD5 Products

Required fields are marked with *

0
cart-icon