Recombinant Human ENTPD5 Protein, GST-tagged

• Cat.No.: ENTPD5-3337H
• Product Overview: Human ENTPD5 full-length ORF ( AAH20966, 1 a.a. - 407 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is similar to E-type nucleotidases (NTPases)/ecto-ATPase/apyrases. NTPases, such as CD39, mediate catabolism of extracellular nucleotides. ENTPD5 contains 4 apyrase-conserved regions which is characteristic of NTPases. [provided by RefSeq, Jan 2009]
• Molecular Mass: 70.18 kDa
• AA Sequence: MATSWGTVFFMLVVSCVCSAVSHRNQQTWFEGIFLSSMCPINVSASTLYGIMFDAGSTGTRIHVYTFVQKMPGQLPILEGEVFDSVKPGLSAFVDQPKQGAETVQGLLEVAKDSIPRSHWKKTPVVLKATAGLRLLPEHKAKALLFEVKEIFRKSPFLVPKGSVSIMDGSDEGILAWVTVNFLTGQLHGHRQETVGTLDLGGASTQITFLPQFEKTLEQTPRGYLTSFEMFNSTYKLYTHSYLGFGLKAARLATLGALETEGTDGHTFRSACLPRWLEAEWIFGGVKYQYGGNQEGEVGFEPCYAEVLRVVRGKLHQPEEVQRGSFYAFSYYYDRAVDTDMIDYEKGGILKVEDFERKAREVCDNLENFTSGSPFLCMDLSYITALLKDGFGFADSTVLQHIISWVN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ENTPD5 ectonucleoside triphosphate diphosphohydrolase 5 [ Homo sapiens ]
• Official Symbol: ENTPD5
• Synonyms: ENTPD5; ectonucleoside triphosphate diphosphohydrolase 5; CD39L4, PCPH, proto oncogene CPH; NTPDase 5; ER-UDPase; CD39-like 4; GDPase ENTPD5; UDPase ENTPD5; proto-oncogene CPH; CD39 antigen-like 4; nucleoside diphosphatase; Pcph proto-oncogene protein; uridine-diphosphatase ENTPD5; guanosine-diphosphatase ENTPD5; PCPH; CD39L4; NTPDase-5; MGC163357; MGC163359
• Gene ID: 957
• mRNA Refseq: NM_001249
• Protein Refseq: NP_001240
• MIM: 603162
• UniProt ID: O75356