Recombinant Human ENY2 Protein, GST-tagged
| Cat.No. : | ENY2-3343H |
| Product Overview : | Human ENY2 full-length ORF (NP_064574.1, 1 a.a. - 101 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | ENY2 (ENY2, Transcription And Export Complex 2 Subunit) is a Protein Coding gene. Among its related pathways are Chromatin organization. GO annotations related to this gene include transcription coactivator activity and ligand-dependent nuclear receptor transcription coactivator activity. |
| Molecular Mass : | 37.51 kDa |
| AA Sequence : | MVVSKMNKDAQMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLEHVTVDDLVAEITPKGRALVPDSVKKELLQRIRTFLAQHASL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ENY2 enhancer of yellow 2 homolog (Drosophila) [ Homo sapiens ] |
| Official Symbol | ENY2 |
| Synonyms | DC6; e(y)2; ENY2; enhancer of yellow 2 homolog (Drosophila); ENY2, Transcription And Export Complex 2 Subunit 2; Enhancer Of Yellow 2 Transcription Factor Homolog; Enhancer Of Yellow 2 Homolog (Drosophila); Transcription And MRNA Export Factor ENY2; Enhancer Of Yellow 2 Homolog; E(Y)2; Sus1 |
| Gene ID | 56943 |
| mRNA Refseq | NM_020189 |
| Protein Refseq | NP_064574 |
| UniProt ID | Q9NPA8 |
| ◆ Recombinant Proteins | ||
| ENY2-1480R | Recombinant Rhesus monkey ENY2 Protein, His-tagged | +Inquiry |
| ENY2-561Z | Recombinant Zebrafish ENY2 | +Inquiry |
| ENY2-3343H | Recombinant Human ENY2 Protein, GST-tagged | +Inquiry |
| ENY2-1305R | Recombinant Rhesus Macaque ENY2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ENY2-5226M | Recombinant Mouse ENY2 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ENY2 Products
Required fields are marked with *
My Review for All ENY2 Products
Required fields are marked with *
