Recombinant Human ENY2 Protein, GST-tagged

Cat.No. : ENY2-3343H
Product Overview : Human ENY2 full-length ORF (NP_064574.1, 1 a.a. - 101 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ENY2 (ENY2, Transcription And Export Complex 2 Subunit) is a Protein Coding gene. Among its related pathways are Chromatin organization. GO annotations related to this gene include transcription coactivator activity and ligand-dependent nuclear receptor transcription coactivator activity.
Molecular Mass : 37.51 kDa
AA Sequence : MVVSKMNKDAQMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLEHVTVDDLVAEITPKGRALVPDSVKKELLQRIRTFLAQHASL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ENY2 enhancer of yellow 2 homolog (Drosophila) [ Homo sapiens ]
Official Symbol ENY2
Synonyms DC6; e(y)2; ENY2; enhancer of yellow 2 homolog (Drosophila); ENY2, Transcription And Export Complex 2 Subunit 2; Enhancer Of Yellow 2 Transcription Factor Homolog; Enhancer Of Yellow 2 Homolog (Drosophila); Transcription And MRNA Export Factor ENY2; Enhancer Of Yellow 2 Homolog; E(Y)2; Sus1
Gene ID 56943
mRNA Refseq NM_020189
Protein Refseq NP_064574
UniProt ID Q9NPA8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ENY2 Products

Required fields are marked with *

My Review for All ENY2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon