Recombinant Human EPAS1 protein, His-tagged
Cat.No. : | EPAS1-3021H |
Product Overview : | Recombinant Human EPAS1 protein(521-870 aa), fused to His tag, was expressed in E. coli. |
Availability | May 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 521-870 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | FNELDLETLAPYIPMDGEDFQLSPICPEERLLAENPQSTPQHCFSAMTNIFQPLAPVAPHSPFLLDKFQQQLESKKTEPEHRPMSSIFFDAGSKASLPPCCGQASTPLSSMGGRSNTQWPPDPPLHFGPTKWAVGDQRTEFLGAAPLGPPVSPPHVSTFKTRSAKGFGARGPDVLSPAMVALSNKLKLKRQLEYEEQAFQDLSGGDPPGGSTSHLMWKRMKNLRGGSCPLMPDKPLSANVPNDKFTQNPMRGLGHPLRHLPLPQPPSAISPGENSKSRFPPQCYATQYQDYSLSSAHKVSGMASRLLGPSFESYLLPELTRYDCEVNVPVLGSSTLLQGGDLLRALDQAT |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | EPAS1 endothelial PAS domain protein 1 [ Homo sapiens ] |
Official Symbol | EPAS1 |
Synonyms | EPAS1; endothelial PAS domain protein 1; endothelial PAS domain-containing protein 1; bHLHe73; HIF 1 alpha like factor; HIF2A; HLF; MOP2; PASD2; EPAS-1; HIF2-alpha; HIF-2-alpha; HIF-1alpha-like factor; HIF-1-alpha-like factor; member of PAS protein 2; PAS domain-containing protein 2; hypoxia-inducible factor 2 alpha; hypoxia-inducible factor 2-alpha; basic-helix-loop-helix-PAS protein MOP2; class E basic helix-loop-helix protein 73; ECYT4; |
Gene ID | 2034 |
mRNA Refseq | NM_001430 |
Protein Refseq | NP_001421 |
MIM | 603349 |
UniProt ID | Q99814 |
◆ Recombinant Proteins | ||
EPAS1-29318TH | Recombinant Human EPAS1 | +Inquiry |
EPAS1-3349H | Recombinant Human EPAS1 Protein, GST-tagged | +Inquiry |
EPAS1-1772R | Recombinant Rat EPAS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
EPAS1-2173H | Recombinant Human EPAS1 Protein, His-tagged | +Inquiry |
EPAS1-8053H | Recombinant Human EPAS1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EPAS1-6588HCL | Recombinant Human EPAS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EPAS1 Products
Required fields are marked with *
My Review for All EPAS1 Products
Required fields are marked with *
0
Inquiry Basket