Recombinant Human EPB41L4B Protein, GST-tagged
Cat.No. : | EPB41L4B-3359H |
Product Overview : | Human EPB41L4B full-length ORF (BAA91133.1, 1 a.a. - 440 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | EPB41L4B (Erythrocyte Membrane Protein Band 4.1 Like 4B) is a Protein Coding gene. Among its related pathways are Tight junction. GO annotations related to this gene include structural constituent of cytoskeleton and cytoskeletal protein binding. An important paralog of this gene is EPB41L5. |
Molecular Mass : | 77.8 kDa |
AA Sequence : | MKFLLIKDAPGKKKRKNLMLSFKRKHAKGQDLFDQIVYHLDLVETDYFGLQFLDSAQVAHWLDHAKPIKKQMKIGPAYALHFRVKYYSSEPNNLREEFTRYLFVLQLRHDILSGKLKCPYETAVELAALCLQAELGECELPEHTPELVSEFRFIPNQTEAMEFDIFQRWKECRGKSPAQAELSYLNKAKWLEMYGVDMHVVRGRDGCEYSLGLTPTGILIFEGANKIGLFFWPKITKMDFKKSKLTLVVVEDDDQGREQEHTFVFRLDSARTCKHLWKCAVEHHAFFRLRTPGNSKSNRSDFIRLGSRFRFSGRTEYQATHGSRLRRTSTFERKPSKRYPSRRHSTFKASNPVIAAQLCSKTNPEVHNYQPQYHPNIHPSQPRWHPHSPNVRPSFQDDRSHWKASASGDDSHFDYVHDQNQKNLGGMQSMMYRDKLMTAL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EPB41L4B erythrocyte membrane protein band 4.1 like 4B [ Homo sapiens ] |
Official Symbol | EPB41L4B |
Synonyms | EPB41L4B; erythrocyte membrane protein band 4.1 like 4B; band 4.1-like protein 4B; EHM2; FERM-containing protein CG1; CG1; FLJ21596; DKFZp761N1814; |
Gene ID | 54566 |
mRNA Refseq | NM_018424 |
Protein Refseq | NP_060894 |
MIM | 610340 |
UniProt ID | Q9H329 |
◆ Recombinant Proteins | ||
EPB41L4B-4263HF | Recombinant Full Length Human EPB41L4B Protein, GST-tagged | +Inquiry |
EPB41L4B-985H | Recombinant Human EPB41L4B | +Inquiry |
EPB41L4B-2863H | Recombinant Human EPB41L4B Protein, His (Fc)-Avi-tagged | +Inquiry |
EPB41L4B-2117R | Recombinant Rat EPB41L4B Protein | +Inquiry |
EPB41L4B-3359H | Recombinant Human EPB41L4B Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EPB41L4B Products
Required fields are marked with *
My Review for All EPB41L4B Products
Required fields are marked with *