Recombinant Human EPB41L5 protein, GST-tagged

• Cat.No.: EPB41L5-301543H
• Product Overview: Recombinant Human EPB41L5 (349-445 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Gly349-Lys445
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: GKTEYQTTKTNKARRSTSFERRPSKRYSRRTLQMKACATKPEELSVHNNVSTQSNGSQQAWGMRSALPVSPSISSAPVPVEIENLPQSPGTDQHDRK
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: EPB41L5 erythrocyte membrane protein band 4.1 like 5 [ Homo sapiens ]
• Official Symbol: EPB41L5
• Synonyms: EPB41L5; erythrocyte membrane protein band 4.1 like 5; band 4.1-like protein 5; BE37; FLJ12957; KIAA1548; YMO1
• Gene ID: 57669
• mRNA Refseq: NM_001184937
• Protein Refseq: NP_001171866
• MIM: 611730
• UniProt ID: Q9HCM4