Recombinant Human EPB42

Cat.No. : EPB42-26437TH
Product Overview : Recombinant fragment of Human EPB42 with an N terminal proprietary tag; Predicted MW 36.52kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 99 amino acids
Description : Erythrocyte membrane protein band 4.2 is an ATP-binding protein which may regulate the association of protein 3 with ankyrin. It probably has a role in erythrocyte shape and mechanical property regulation. Mutations in the EPB42 gene are associated with recessive spherocytic elliptocytosis and recessively transmitted hereditary hemolytic anemia. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Molecular Weight : 36.520kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : KMPEKAEQYQPLTASVSLQNSLDAPMEDCVISILGRGLIHRERSYRFRSVWPENTMCAKFQFTPTHVGLQRLTVEVDCNMFQNLTNYKSVTVVAPELSA
Sequence Similarities : Belongs to the transglutaminase superfamily. Transglutaminase family.
Gene Name EPB42 erythrocyte membrane protein band 4.2 [ Homo sapiens ]
Official Symbol EPB42
Synonyms EPB42; erythrocyte membrane protein band 4.2; Erythrocyte surface protein band 4.2; MGC116735; MGC116737; PA;
Gene ID 2038
mRNA Refseq NM_000119
Protein Refseq NP_000110
MIM 177070
Uniprot ID P16452
Chromosome Location 15q15-q21
Function ATP binding; protein binding; protein-glutamine gamma-glutamyltransferase activity; structural constituent of cytoskeleton;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EPB42 Products

Required fields are marked with *

My Review for All EPB42 Products

Required fields are marked with *

0
cart-icon
0
compare icon